Lus10000703 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06135 36 / 0.0004 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024873 109 / 2e-32 ND 37 / 2e-04
Lus10024872 101 / 5e-29 ND 39 / 3e-05
Lus10014739 71 / 5e-17 ND 40 / 2e-05
Lus10005525 37 / 0.0004 ND 40 / 1e-05
Lus10006567 37 / 0.0004 ND 35 / 0.001
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G221200 48 / 2e-08 AT2G31335 / unknown protein
Potri.013G043600 48 / 4e-08 AT1G06135 39 / 3e-05 unknown protein
Potri.002G041950 42 / 6e-06 AT2G31335 / unknown protein
Potri.010G075100 39 / 4e-05 ND /
Potri.019G013000 40 / 5e-05 AT2G31335 / unknown protein
Potri.001G380300 39 / 5e-05 AT1G06137 40 / 2e-05 unknown protein
Potri.008G163000 37 / 0.0002 AT2G31335 40 / 1e-05 unknown protein
PFAM info
Representative CDS sequence
>Lus10000703 pacid=23144357 polypeptide=Lus10000703 locus=Lus10000703.g ID=Lus10000703.BGIv1.0 annot-version=v1.0
ATGGGTTTCGTATCTCGAAGGAAGATCATCATCTTTCTTCTGGTTCTGCTTCTTTTCTGGGCTTCGGTTTTCCAGCCTGCTGAAATGAGACCACTCAAGC
AAGAATACTATGATGATGATCCCAGTTTACTAATCCTACGACAGTCTTTGCAGAAGGGTCCGGTTGGAGGGTCGGGTCCAAACCCATGCACCAACATCGG
CGGTCGGAACCCTGGATCCTGCACCCGTGCGGCTGTTGGTGCCATGAACTTTGCCGGCAATATTGCCTCCGCCCGACCGCCGCCTCCTCCTCTAGCCGTT
GTCGCAGCTGATATATAA
AA sequence
>Lus10000703 pacid=23144357 polypeptide=Lus10000703 locus=Lus10000703.g ID=Lus10000703.BGIv1.0 annot-version=v1.0
MGFVSRRKIIIFLLVLLLFWASVFQPAEMRPLKQEYYDDDPSLLILRQSLQKGPVGGSGPNPCTNIGGRNPGSCTRAAVGAMNFAGNIASARPPPPPLAV
VAADI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06135 unknown protein Lus10000703 0 1
Lus10043316 1.7 0.9945
AT2G38870 Serine protease inhibitor, pot... Lus10018786 1.7 0.9927
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10002357 3.7 0.9938
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10003148 6.6 0.9920
AT1G17860 Kunitz family trypsin and prot... Lus10039163 7.3 0.9877
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10039646 9.2 0.9874
AT1G13110 CYP71B7 "cytochrome P450, family 71 su... Lus10034230 11.4 0.9893
AT1G11925 Stigma-specific Stig1 family p... Lus10020831 11.5 0.9864
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10030931 11.8 0.9849
AT3G09520 ATEXO70H4 exocyst subunit exo70 family p... Lus10024438 13.0 0.9873

Lus10000703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.