Gene [FLAX] | FIBexDB

Lus10000720 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TAIR10 short description
AT1G17930	49 / 1e-07	Aminotransferase-like, plant mobile domain family protein (.1)
AT2G25010	45 / 4e-06	Aminotransferase-like, plant mobile domain family protein (.1)
AT2G04865	43 / 2e-05	Aminotransferase-like, plant mobile domain family protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10003728 [exp]	176 / 2e-57	AT2G04865	54 / 5e-09	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10000607 [exp]	162 / 4e-51	AT2G25010	47 / 4e-06	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10033204 [exp]	147 / 1e-44	AT2G25010	50 / 4e-07	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10033216 [exp]	142 / 1e-41	AT1G48120	41 / 0.002	hydrolases;protein serine/threonine phosphatases (.1)
Lus10005722 [exp]	136 / 3e-41	ND	/
Lus10036654 [exp]	131 / 3e-40	AT1G50750	44 / 6e-06	Plant mobile domain protein family (.1)
Lus10020617 [exp]	115 / 3e-33	AT2G04865	40 / 3e-04	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10003026 [exp]	111 / 1e-30	AT2G25010	45 / 4e-05	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10033415 [exp]	96 / 1e-26	AT1G17930	53 / 1e-09	Aminotransferase-like, plant mobile domain family protein (.1)

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF10536 [flax] [poplar]	PMD	Plant mobile domain

Representative CDS sequence

Show only first row Show all

>Lus10000720 pacid=23149272 polypeptide=Lus10000720 locus=Lus10000720.g ID=Lus10000720.BGIv1.0 annot-version=v1.0

ATGACTCGGGAGTACAGTTGGGGTGCGGCTACACTTGCTTTTCTGTACATGCAGCGTGGGGTTGCTTCTAGTGCGCGATCTACGTCCATGTCGGGCTGCC

GTACTTTGCAGCTGTCGTGGATCTACGAGTACTTCTCGAGGTTGCGTCGTAGGCCGTCCCCGACCCCACGTGCTTGTGGGGAGGCACTTGCTGGGAGGTG

GGATGGACCGAGGATCGTTGAGAGAGCAGCTGACGCTGGTGCGAGGCTACACACACTACGCTCGATTTTGGATGGGATGACGCACGCACAGATCGAGTGG

CTTCCGTTCGGTTCACCCGATTTCGACGGTGAGACTCGGTGGTTCTTATACAGTGGAGGCATACACGCATTTTACTACATAGAGCCCCACGATGCCAGTC

ACGTGTTGCGACAGTACGGCTATCTAGACGATCCCTGA

AA sequence

Show only first row Show all

>Lus10000720 pacid=23149272 polypeptide=Lus10000720 locus=Lus10000720.g ID=Lus10000720.BGIv1.0 annot-version=v1.0

MTREYSWGAATLAFLYMQRGVASSARSTSMSGCRTLQLSWIYEYFSRLRRRPSPTPRACGEALAGRWDGPRIVERAADAGARLHTLRSILDGMTHAQIEW

LPFGSPDFDGETRWFLYSGGIHAFYYIEPHDASHVLRQYGYLDDP

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17930			Aminotransferase-like, plant m...		Lus10000720 [exp]	0	1

Lus10000720 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.