Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35736 73 / 1e-19 unknown protein AT4G25225 59 / 4e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028935 [exp] 79 / 9e-22 AT2G35736 96 / 2e-28 unknown protein Lus10004354 [exp] 79 / 1e-21 AT2G35736 95 / 4e-28 unknown protein Lus10027209 [exp] 57 / 5e-13 AT4G25225 82 / 8e-23 unknown protein Lus10038922 [exp] 57 / 2e-12 AT4G25225 81 / 2e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G123000 [exp] 72 / 4e-19 AT2G35736 91 / 1e-26 unknown protein Potri.001G124100 [exp] 63 / 2e-15 AT4G25225 90 / 6e-26 unknown protein Potri.014G059600 [exp] 56 / 2e-12 AT4G25225 87 / 8e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000732 pacid=23140528 polypeptide=Lus10000732 locus=Lus10000732.g ID=Lus10000732.BGIv1.0 annot-version=v1.0 ATGGGGATCTTCTCCTTCATCGCCGGTGCATTCGTCGGAATCTACGTCGCTCAGAACTACAACGTCCCTAACTTGCAGAAGCTGGTCAGCACAGGGAAGG TCCTCGCTGAACACATAGACGAGTCTTACAGGAAGCCGAAGAAGCCAGATGTTCAGGATTGA
AA sequence Show only first row Show all	>Lus10000732 pacid=23140528 polypeptide=Lus10000732 locus=Lus10000732.g ID=Lus10000732.BGIv1.0 annot-version=v1.0 MGIFSFIAGAFVGIYVAQNYNVPNLQKLVSTGKVLAEHIDESYRKPKKPDVQD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35736			unknown protein		Lus10000732 [exp]	0	1
AT3G63150		ATCBG, MIRO2	CALCIUM BINDING GTP-ASE, MIRO-...		Lus10042575 [exp]	3.7	0.7765
AT1G69850		NTL1, ATNRT1:2	nitrate transporter 1:2 (.1)		Lus10015240 [exp]	6.6	0.8084
AT3G50740		UGT72E1	UDP-glucosyl transferase 72E1 ...		Lus10041715 [exp]	7.3	0.7763
AT3G63150		ATCBG, MIRO2	CALCIUM BINDING GTP-ASE, MIRO-...		Lus10022034 [exp]	10.2	0.7435
AT3G23940			dehydratase family (.1.2)		Lus10032616 [exp]	11.0	0.7502
AT3G49190			O-acyltransferase (WSD1-like) ...		Lus10033678 [exp]	13.1	0.7591
AT5G62310		IRE	INCOMPLETE ROOT HAIR ELONGATIO...		Lus10027196 [exp]	17.5	0.7656
AT5G19500			Tryptophan/tyrosine permease (...		Lus10036527 [exp]	19.9	0.7738
AT3G43600		AtAO3, atAO-2, ...	Arabidopsis thaliana aldehyde ...		Lus10040474 [exp]	21.5	0.7650
AT2G36390		SBE2.1, BE3	BRANCHING ENZYME 3, starch bra...		Lus10023878 [exp]	25.9	0.6771

Compare expression of checked genes

Lus10000732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.