Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16520 218 / 7e-75 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2) AT3G60640 212 / 2e-72 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) AT2G45170 207 / 2e-70 ATATG8E AUTOPHAGY 8E (.1.2) AT1G62040 201 / 4e-68 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2) AT2G05630 199 / 1e-67 ATG8D Ubiquitin-like superfamily protein (.1.2) AT4G21980 191 / 7e-64 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) AT4G04620 182 / 5e-61 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2) AT3G15580 132 / 3e-41 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) AT3G06420 125 / 3e-38 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008507 [exp] 245 / 2e-85 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10028933 [exp] 222 / 2e-76 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10004352 [exp] 207 / 3e-70 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2) Lus10015563 [exp] 204 / 2e-69 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Lus10027186 [exp] 197 / 7e-67 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2) Lus10039656 [exp] 180 / 6e-59 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2) Lus10038046 [exp] 132 / 6e-41 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Lus10009987 [exp] 122 / 2e-33 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G144600 [exp] 223 / 5e-77 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) Potri.008G136040 [exp] 223 / 6e-77 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.003G110901 [exp] 223 / 6e-77 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.001G122700 [exp] 218 / 3e-75 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.014G060300 [exp] 216 / 5e-74 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.002G228800 [exp] 201 / 2e-68 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2) Potri.014G153800 [exp] 201 / 3e-68 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2) Potri.011G004300 [exp] 194 / 5e-65 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) Potri.004G013700 [exp] 191 / 2e-64 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Potri.008G099400 [exp] 133 / 1e-41 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02991 [flax] [poplar] Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence Show only first row Show all	>Lus10000733 pacid=23140526 polypeptide=Lus10000733 locus=Lus10000733.g ID=Lus10000733.BGIv1.0 annot-version=v1.0 ATGGCTAAGAGTTCTTTCAAGCAAGAGCATGACTATGAGAAGAGAAAAGCTGAGGCTGACAGGATAAGGGAGAAATATTCCGATAGGATTCCGGTCATCG TGGAGAAGGCAGAGAGAAGTGAAATACCAAATATAGATAAGAAAAAGTACCTAGTCCCAGCAGACTTGACAGTGGGGCAGTTTGTTTATGTAATCCGGAA AAGGATCAAGTTGAGTGCCGAAAAGGCCATCTTCATATTCGTCGACAACGTCCTGCCACCTACCGGTGCTATAATGTCTTCGATATACGAAGAGAAGAAG GACGAGGACGGGTTTCTGTATGTTACTTACAGCGGCGAGAACACCTTCGGGGACAAAGAGATTCAGCTCTAG
AA sequence Show only first row Show all	>Lus10000733 pacid=23140526 polypeptide=Lus10000733 locus=Lus10000733.g ID=Lus10000733.BGIv1.0 annot-version=v1.0 MAKSSFKQEHDYEKRKAEADRIREKYSDRIPVIVEKAERSEIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSSIYEEKK DEDGFLYVTYSGENTFGDKEIQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10000733 [exp]	0	1
AT1G04970			lipid-binding serum glycoprote...		Lus10033808 [exp]	1.0	0.9746
AT1G68300			Adenine nucleotide alpha hydro...		Lus10041436 [exp]	2.2	0.9677
AT1G21000			PLATZ transcription factor fam...		Lus10002700 [exp]	4.2	0.9700
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10022727 [exp]	5.3	0.9696
AT5G65210	bZIP	TGA1	bZIP transcription factor fami...		Lus10035873 [exp]	5.5	0.9701
AT1G11905			B-cell receptor-associated pro...		Lus10000048 [exp]	5.5	0.9554
AT1G08110			lactoylglutathione lyase famil...		Lus10016138 [exp]	6.0	0.9547
AT1G44770			unknown protein		Lus10034500 [exp]	6.0	0.9656
AT5G49710			unknown protein		Lus10015965 [exp]	8.9	0.9567
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Lus10009376 [exp]	11.2	0.9539

Compare expression of checked genes

Lus10000733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.