Lus10000745 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65220 162 / 3e-51 Ribosomal L29 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019653 208 / 4e-68 AT5G65220 87 / 5e-21 Ribosomal L29 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G093700 197 / 3e-65 AT5G65220 166 / 6e-53 Ribosomal L29 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0346 Ribo_L29 PF00831 Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence
>Lus10000745 pacid=23166268 polypeptide=Lus10000745 locus=Lus10000745.g ID=Lus10000745.BGIv1.0 annot-version=v1.0
ATGTTGAGCTTGTCAATTGCTGCTGCTACTTCACTCCCCAAGCTCTCCCTCCCATTCCACACCCACAACAAATCCTCATTCGCCGGCGTCCAAATCCCCC
AGAAATGCCGCCTCCTCCCAATTCGCAGGACGGCGGCGGCTTCGGTGGTAATGATGGCGAAGAAAGACGACGAGTTGAAGGAGATTAGGACGCTGACCAC
CGAAGAGATCAACGAGCAGGTCGTGGACCTTAAAGGCGAGCTCTTCATGCTCCGCTTACAAAAGTCCGTCAGGAACGAGTTCAAGTCCAGCGAATTCCGC
CGCATGCGTAAAAAGATCGCACGAATGCTGACGGTGAAACGGGAAAGGGAGATCGAAGAAGGTATCAACAAGAGGATATCGAGGAAGCTGGACCGGCAAT
GGAAGAGAAGCATTGTGGTGAGACCGCCTCCTTCCTTGAAGAAGAAGGAGGAAGAGGCTGCAGCAGAAGCGGCCGCTGCTGCTGCGAAATCTGCTTGA
AA sequence
>Lus10000745 pacid=23166268 polypeptide=Lus10000745 locus=Lus10000745.g ID=Lus10000745.BGIv1.0 annot-version=v1.0
MLSLSIAAATSLPKLSLPFHTHNKSSFAGVQIPQKCRLLPIRRTAAASVVMMAKKDDELKEIRTLTTEEINEQVVDLKGELFMLRLQKSVRNEFKSSEFR
RMRKKIARMLTVKREREIEEGINKRISRKLDRQWKRSIVVRPPPSLKKKEEEAAAEAAAAAAKSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65220 Ribosomal L29 family protein ... Lus10000745 0 1
AT5G14320 EMB3137 EMBRYO DEFECTIVE 3137, Ribosom... Lus10025642 1.0 0.9897
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Lus10037822 1.4 0.9846
AT2G33450 Ribosomal L28 family (.1) Lus10023747 3.2 0.9752
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10033200 3.5 0.9790
AT3G44890 RP19, RPL9 ribosomal protein L9 (.1) Lus10037372 4.0 0.9737
AT2G42220 Rhodanese/Cell cycle control p... Lus10023820 4.0 0.9766
AT5G22340 unknown protein Lus10043400 4.6 0.9738
AT4G02725 unknown protein Lus10014675 6.0 0.9733
AT5G22340 unknown protein Lus10034185 7.1 0.9580
AT2G33450 Ribosomal L28 family (.1) Lus10011792 7.5 0.9673

Lus10000745 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.