Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000749 pacid=23166261 polypeptide=Lus10000749 locus=Lus10000749.g ID=Lus10000749.BGIv1.0 annot-version=v1.0 ATGGAGAAGCAGCATCACACGCCTTCCTTCATCAAGGTCTTCTACCTAGACTCGGCCGAAGAACTCGGAAGTCAATTCTGGATTCATTCGTTGACCAACA CGACCAGCTTCTCCCGGAGAAGCTGGCTCTTCTGCCGGGTTACGAAAACCAATGGTGGTCTCCGTGTAGAGGAGAAGTAG
AA sequence Show only first row Show all	>Lus10000749 pacid=23166261 polypeptide=Lus10000749 locus=Lus10000749.g ID=Lus10000749.BGIv1.0 annot-version=v1.0 MEKQHHTPSFIKVFYLDSAEELGSQFWIHSLTNTTSFSRRSWLFCRVTKTNGGLRVEEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000749 [exp]	0	1
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10024584 [exp]	2.2	0.9351
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10025619 [exp]	3.7	0.9273
AT1G18790		AtRKD1, RKD1	RWP-RK domain containing 1, RW...		Lus10019100 [exp]	4.6	0.9273
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10040632 [exp]	5.3	0.9273
AT2G39040			Peroxidase superfamily protein...		Lus10041250 [exp]	6.0	0.9245
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10007025 [exp]	6.3	0.9250
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10008892 [exp]	7.1	0.8072
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10005010 [exp]	7.5	0.9068
AT4G21330	bHLH	bHLH022, DYT1	DYSFUNCTIONAL TAPETUM 1, basic...		Lus10007618 [exp]	8.4	0.8961
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10016188 [exp]	10.6	0.8681

Compare expression of checked genes

Lus10000749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.