Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033093 [exp] 47 / 6e-09 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000768 pacid=23171867 polypeptide=Lus10000768 locus=Lus10000768.g ID=Lus10000768.BGIv1.0 annot-version=v1.0 ATGTCATTATCAAAGATATTATGTTGGAAAATACTTACAGATGTTGGAAAGTCTGGTTTTCAAGATTTGGATGGTTGCTTTTCTACTTTGGCAATGGAGG ATGCGAGCCGTGAAGATTTTGAAATGGGAGATTTGCAAGGTGAAGGAGGTGGTCAAGGAGGTCGAGCACAACCAGATTTGGACATGGAAGACTAA
AA sequence Show only first row Show all	>Lus10000768 pacid=23171867 polypeptide=Lus10000768 locus=Lus10000768.g ID=Lus10000768.BGIv1.0 annot-version=v1.0 MSLSKILCWKILTDVGKSGFQDLDGCFSTLAMEDASREDFEMGDLQGEGGGQGGRAQPDLDMED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000768 [exp]	0	1
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10042994 [exp]	3.0	0.8554
AT4G02210			unknown protein		Lus10027531 [exp]	3.9	0.8119
AT4G30780			unknown protein		Lus10035819 [exp]	5.1	0.8250
AT3G54670		ATSMC1, TTN8	TITAN8, STRUCTURAL MAINTENANCE...		Lus10013582 [exp]	11.0	0.7489
AT4G27790			Calcium-binding EF hand family...		Lus10022381 [exp]	11.2	0.8197
AT3G21070		NADK1, ATNADK-1	NAD kinase 1 (.1.2)		Lus10009958 [exp]	11.2	0.7970
AT5G67140			F-box/RNI-like superfamily pro...		Lus10024178 [exp]	12.2	0.7923
AT1G16650			S-adenosyl-L-methionine-depend...		Lus10005589 [exp]	14.1	0.7931
AT4G09760			Protein kinase superfamily pro...		Lus10028728 [exp]	15.7	0.7937
AT4G36210			Protein of unknown function (D...		Lus10010626 [exp]	15.8	0.7429

Compare expression of checked genes

Lus10000768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.