Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30950 99 / 5e-26 FTSH2, VAR2 VARIEGATED 2, FtsH extracellular protease family (.1) AT1G06430 91 / 4e-23 FTSH8 FTSH protease 8 (.1) AT5G15250 86 / 2e-21 FTSH6, ATFTSH6 FTSH protease 6 (.1.2) AT5G42270 62 / 7e-13 FTSH5, VAR1 VARIEGATED 1, FtsH extracellular protease family (.1) AT1G50250 56 / 6e-11 FTSH1 FTSH protease 1 (.1) AT4G23940 51 / 3e-09 FtsH extracellular protease family (.1) AT5G58870 50 / 6e-09 FTSH9 FTSH protease 9 (.1) AT3G47060 49 / 2e-08 FTSH7 FTSH protease 7 (.1) AT2G29080 45 / 5e-07 FTSH3 FTSH protease 3 (.1) AT5G53170 44 / 8e-07 FTSH11 FTSH protease 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001420 [exp] 97 / 2e-25 AT2G30950 1155 / 0.0 VARIEGATED 2, FtsH extracellular protease family (.1) Lus10001054 [exp] 97 / 3e-25 AT2G30950 1154 / 0.0 VARIEGATED 2, FtsH extracellular protease family (.1) Lus10012277 [exp] 58 / 1e-11 AT1G50250 935 / 0.0 FTSH protease 1 (.1) Lus10016003 [exp] 58 / 2e-11 AT5G42270 1129 / 0.0 VARIEGATED 1, FtsH extracellular protease family (.1) Lus10021824 [exp] 57 / 2e-11 AT5G42270 934 / 0.0 VARIEGATED 1, FtsH extracellular protease family (.1) Lus10018210 [exp] 53 / 1e-09 AT5G58870 1049 / 0.0 FTSH protease 9 (.1) Lus10001203 [exp] 51 / 4e-09 AT5G58870 1093 / 0.0 FTSH protease 9 (.1) Lus10005868 [exp] 51 / 5e-09 AT5G58870 1105 / 0.0 FTSH protease 9 (.1) Lus10040695 [exp] 46 / 2e-07 AT5G58870 1047 / 0.0 FTSH protease 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G215100 [exp] 94 / 3e-24 AT2G30950 1040 / 0.0 VARIEGATED 2, FtsH extracellular protease family (.1) Potri.014G139500 [exp] 93 / 6e-24 AT2G30950 1057 / 0.0 VARIEGATED 2, FtsH extracellular protease family (.1) Potri.002G220366 [exp] 78 / 4e-19 AT1G06430 405 / 1e-138 FTSH protease 8 (.1) Potri.017G084000 [exp] 75 / 1e-17 AT5G15250 959 / 0.0 FTSH protease 6 (.1.2) Potri.002G012000 [exp] 58 / 1e-11 AT5G42270 1094 / 0.0 VARIEGATED 1, FtsH extracellular protease family (.1) Potri.005G249200 [exp] 57 / 3e-11 AT5G42270 1077 / 0.0 VARIEGATED 1, FtsH extracellular protease family (.1) Potri.009G043100 [exp] 52 / 2e-09 AT5G58870 1039 / 0.0 FTSH protease 9 (.1) Potri.001G249100 [exp] 52 / 3e-09 AT5G58870 997 / 0.0 FTSH protease 9 (.1) Potri.001G089800 [exp] 50 / 1e-08 AT4G23940 1241 / 0.0 FtsH extracellular protease family (.1) Potri.006G227700 [exp] 47 / 1e-07 AT2G26140 1066 / 0.0 FTSH protease 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000769 pacid=23171865 polypeptide=Lus10000769 locus=Lus10000769.g ID=Lus10000769.BGIv1.0 annot-version=v1.0 ATGGGCTGTCCTGGAGGCCCTGGTAACCCCCTTGCCTTTGGTCAATCTAAGGCAAAGTGCCATATGGAGCCAAACACTTGGGTGACATTCAATGATGTTG CTGGAGTTGATGAAGCAAAGCAAGATTTCATGGAAGTTGTGGAGTTCATTAAGAAGCCTGAGAGATTTACTTCTATTGGAGCTGGCAAGCAAATGCGTGA ATTCTGCATTTCATGA
AA sequence Show only first row Show all	>Lus10000769 pacid=23171865 polypeptide=Lus10000769 locus=Lus10000769.g ID=Lus10000769.BGIv1.0 annot-version=v1.0 MGCPGGPGNPLAFGQSKAKCHMEPNTWVTFNDVAGVDEAKQDFMEVVEFIKKPERFTSIGAGKQMREFCIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15250		FTSH6, ATFTSH6	FTSH protease 6 (.1.2)		Lus10000769 [exp]	0	1
AT5G61980		AGD1	ARF-GAP domain 1 (.1)		Lus10036018 [exp]	23.5	0.7584
AT2G03667			Asparagine synthase family pro...		Lus10004643 [exp]	35.3	0.7376
AT2G39580			unknown protein		Lus10005958 [exp]	58.1	0.7345
					Lus10000768 [exp]	85.4	0.7000
AT1G79050			recA DNA recombination family ...		Lus10042462 [exp]	124.8	0.6617

Compare expression of checked genes

Lus10000769 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.