Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25810 47 / 8e-07 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT2G24210 45 / 2e-06 AtTPS10 terpene synthase 10 (.1) AT3G25830 43 / 2e-05 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) AT3G25820 43 / 2e-05 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2) AT4G16730 41 / 5e-05 AtTPS02 terpene synthase 02 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001110 [exp] 66 / 2e-13 AT3G25810 362 / 1e-118 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10038179 [exp] 66 / 2e-13 AT3G25810 351 / 2e-113 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10033643 [exp] 64 / 5e-13 AT4G16730 356 / 2e-115 terpene synthase 02 (.1) Lus10025922 [exp] 63 / 1e-12 AT3G25810 353 / 3e-114 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10028648 [exp] 56 / 7e-10 AT1G21400 645 / 0.0 Thiamin diphosphate-binding fold (THDP-binding) superfamily protein (.1) Lus10006356 [exp] 56 / 8e-10 AT3G25820 371 / 3e-121 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2) Lus10012312 [exp] 53 / 7e-09 AT4G16740 363 / 3e-118 terpene synthase 03 (.1.2) Lus10031352 [exp] 49 / 8e-08 AT3G25810 236 / 2e-73 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10006355 [exp] 50 / 9e-08 AT2G24210 361 / 7e-117 terpene synthase 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G023008 [exp] 50 / 4e-08 AT3G25830 535 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023006 [exp] 50 / 4e-08 AT3G25830 540 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023020 [exp] 49 / 7e-08 AT3G25830 440 / 1e-151 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308300 [exp] 49 / 9e-08 AT3G25830 507 / 4e-174 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308200 [exp] 48 / 2e-07 AT3G25810 499 / 4e-171 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.007G119700 [exp] 47 / 7e-07 AT4G16740 438 / 8e-147 terpene synthase 03 (.1.2) Potri.019G023000 [exp] 43 / 2e-05 AT4G16740 208 / 8e-63 terpene synthase 03 (.1.2) Potri.017G041700 [exp] 40 / 0.0001 AT3G25810 432 / 3e-145 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.011G031800 [exp] 40 / 0.0001 AT3G25830 382 / 5e-126 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.007G118600 [exp] 39 / 0.0003 AT4G16740 462 / 3e-157 terpene synthase 03 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01397 [flax] [poplar] Terpene_synth Terpene synthase, N-terminal domain CL0613 [flax] [poplar] Terp_synthase PF03936 [flax] [poplar] Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence Show only first row Show all	>Lus10000770 pacid=23142590 polypeptide=Lus10000770 locus=Lus10000770.g ID=Lus10000770.BGIv1.0 annot-version=v1.0 ATGGATGTTCAGCCTGCTGGGATTCGGGGCATTCGTGACGAGGTCTCGGAGGACAAATTCGTGAGTACCGAAAGTGTCCTTGACAACACGATATCGGTGA AAGAGTTGAAAAAGTACGTGAAAGGTTTGCTAGAGAAGAATGATGATGATGATCAAAAGATGATCACACCGATCAAACAGCTGGAAACGATCGACAACCT CCAACGGCTTGGATTGGGTGAGCTAGAAAGGGGAGATGTAACGAAATCGATGGAATGTTACATGAAAGAGAAAGGGGTTTCGGAAGATGCGGCTCGAGAA CACGTAGAGTTGTTGATCGGTGAAACATGGAAGATGGACAATCAAGACATAGGTTTCCTCCAAGCATAA
AA sequence Show only first row Show all	>Lus10000770 pacid=23142590 polypeptide=Lus10000770 locus=Lus10000770.g ID=Lus10000770.BGIv1.0 annot-version=v1.0 MDVQPAGIRGIRDEVSEDKFVSTESVLDNTISVKELKKYVKGLLEKNDDDDQKMITPIKQLETIDNLQRLGLGELERGDVTKSMECYMKEKGVSEDAARE HVELLIGETWKMDNQDIGFLQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24210		AtTPS10	terpene synthase 10 (.1)		Lus10000770 [exp]	0	1

Compare expression of checked genes

Lus10000770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.