Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77030 228 / 7e-71 hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides;ATP-dependent helicases;nucleic acid binding;ATP binding;RNA binding;helicases (.1) AT4G16630 109 / 3e-28 DEA(D/H)-box RNA helicase family protein (.1) AT3G61240 107 / 9e-28 DEA(D/H)-box RNA helicase family protein (.1), DEA(D/H)-box RNA helicase family protein (.2) AT5G65900 107 / 2e-27 DEA(D/H)-box RNA helicase family protein (.1) AT2G45810 106 / 2e-27 DEA(D/H)-box RNA helicase family protein (.1) AT4G00660 104 / 9e-27 ATRH8 RNAhelicase-like 8 (.1.2) AT1G16280 103 / 3e-26 SWA3, AtRH36 SLOW WALKER 3, Arabidopsis thaliana RNA helicase 36, RNA helicase 36 (.1) AT2G33730 103 / 4e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G47330 101 / 2e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G60990 99 / 1e-24 DEA(D/H)-box RNA helicase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028644 [exp] 301 / 2e-98 AT1G77030 1057 / 0.0 hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides;ATP-dependent helicases;nucleic acid binding;ATP binding;RNA binding;helicases (.1) Lus10018941 [exp] 296 / 2e-96 AT1G77030 1043 / 0.0 hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides;ATP-dependent helicases;nucleic acid binding;ATP binding;RNA binding;helicases (.1) Lus10042754 [exp] 116 / 2e-30 AT1G16280 983 / 0.0 SLOW WALKER 3, Arabidopsis thaliana RNA helicase 36, RNA helicase 36 (.1) Lus10006736 [exp] 106 / 3e-27 AT3G02065 686 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10029596 [exp] 106 / 4e-27 AT1G16280 674 / 0.0 SLOW WALKER 3, Arabidopsis thaliana RNA helicase 36, RNA helicase 36 (.1) Lus10006326 [exp] 106 / 5e-27 AT1G16280 673 / 0.0 SLOW WALKER 3, Arabidopsis thaliana RNA helicase 36, RNA helicase 36 (.1) Lus10017804 [exp] 105 / 6e-27 AT4G00660 854 / 0.0 RNAhelicase-like 8 (.1.2) Lus10020088 [exp] 105 / 1e-26 AT3G02065 677 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10001272 [exp] 104 / 2e-26 AT5G14610 665 / 0.0 DEAD box RNA helicase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G185900 [exp] 239 / 4e-75 AT1G77030 1106 / 0.0 hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides;ATP-dependent helicases;nucleic acid binding;ATP binding;RNA binding;helicases (.1) Potri.005G241300 [exp] 114 / 9e-30 AT4G16630 829 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Potri.014G081100 [exp] 104 / 1e-26 AT4G00660 822 / 0.0 RNAhelicase-like 8 (.1.2) Potri.002G157500 [exp] 103 / 2e-26 AT4G00660 817 / 0.0 RNAhelicase-like 8 (.1.2) Potri.002G194600 [exp] 103 / 5e-26 AT2G47330 1048 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G152400 [exp] 102 / 1e-25 AT3G06480 801 / 0.0 DEAD box RNA helicase family protein (.1) Potri.008G084700 [exp] 99 / 7e-25 AT1G16280 616 / 0.0 SLOW WALKER 3, Arabidopsis thaliana RNA helicase 36, RNA helicase 36 (.1) Potri.012G045800 [exp] 99 / 1e-24 AT2G33730 994 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.017G071400 [exp] 97 / 5e-24 AT5G14610 792 / 0.0 DEAD box RNA helicase family protein (.1.2) Potri.006G249100 [exp] 95 / 2e-23 AT5G60990 619 / 0.0 DEA(D/H)-box RNA helicase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00270 [flax] [poplar] DEAD DEAD/DEAH box helicase
Representative CDS sequence Show only first row Show all	>Lus10000777 pacid=23142592 polypeptide=Lus10000777 locus=Lus10000777.g ID=Lus10000777.BGIv1.0 annot-version=v1.0 ATGAGAGAGCCGGCGGTGAGCTCCGCTACGGCGCTGGTGATCAACCAGAAGAAGGCCAAGTCAGGTGGATTCGAGTCCCTGAACCTGAGCAGCGATGTAT TCCGAGGAATCAAGCGGAAAGGTTACTGTGTCCCGACTCCGATCCAGCGCAAGACGATGCCGCTCATACTCTCCGGCACCGACGTTGTCGCCATGGCTCG TACGGGTTCGGGGAAGACCGCCGCGTTTCTCATCCCGATGCTGGAGAAGCTAAGGCAGCACGTGCCCCAGGGTGGTGTCAGGGCTTTGATTCTATCGCCG ACCAGGGATTTAGCCATACAGGCGCTCAAGTTCACCAAGGAGCTCGGGAGGTACACTGATCTTCGTACGAGTTTGTTGGTTGGTGGTGACAGCATGGAAA CTCAGTTCGAGGAATTAGCACAAAACCCAGATGTCATAATCGCTACTCCTGGAAGACCCGTTGGCCAATGCAATCACGCTATCGTCTGA
AA sequence Show only first row Show all	>Lus10000777 pacid=23142592 polypeptide=Lus10000777 locus=Lus10000777.g ID=Lus10000777.BGIv1.0 annot-version=v1.0 MREPAVSSATALVINQKKAKSGGFESLNLSSDVFRGIKRKGYCVPTPIQRKTMPLILSGTDVVAMARTGSGKTAAFLIPMLEKLRQHVPQGGVRALILSP TRDLAIQALKFTKELGRYTDLRTSLLVGGDSMETQFEELAQNPDVIIATPGRPVGQCNHAIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77030			hydrolases, acting on acid anh...		Lus10000777 [exp]	0	1
AT5G63460			SAP domain-containing protein ...		Lus10016762 [exp]	7.1	0.8730
AT2G26200			S-adenosyl-L-methionine-depend...		Lus10024993 [exp]	7.7	0.8644
AT1G31970		STRS1	STRESS RESPONSE SUPPRESSOR 1, ...		Lus10000894 [exp]	9.7	0.8718
AT5G46680			Pentatricopeptide repeat (PPR-...		Lus10039036 [exp]	11.7	0.8717
AT5G67530		ATPUB49	plant U-box 49 (.1)		Lus10004731 [exp]	19.9	0.8546
AT5G22030		UBP8	ubiquitin-specific protease 8 ...		Lus10021253 [exp]	21.1	0.8669
AT3G47630			unknown protein		Lus10023597 [exp]	22.4	0.8572
AT4G28220		NDB1	NAD(P)H dehydrogenase B1 (.1)		Lus10039769 [exp]	23.2	0.8617
AT1G05410			Protein of unknown function (D...		Lus10010550 [exp]	28.2	0.8600
AT4G18465			RNA helicase family protein (....		Lus10025127 [exp]	28.5	0.8567

Compare expression of checked genes

Lus10000777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.