Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11720 169 / 3e-50 Glycosyl hydrolases family 31 protein (.1) AT3G45940 155 / 2e-45 Glycosyl hydrolases family 31 protein (.1) AT1G68560 150 / 1e-43 AXY3, TRG1, XYL1, ATXYL1 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) AT5G63840 94 / 9e-24 PSL5, RSW3 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1) AT3G23640 82 / 1e-19 HGL1 heteroglycan glucosidase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008067 [exp] 209 / 3e-64 AT5G11720 1072 / 0.0 Glycosyl hydrolases family 31 protein (.1) Lus10038408 [exp] 179 / 1e-53 AT5G11720 1150 / 0.0 Glycosyl hydrolases family 31 protein (.1) Lus10035020 [exp] 154 / 9e-45 AT1G68560 1238 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10041457 [exp] 153 / 2e-44 AT1G68560 1455 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10034315 [exp] 152 / 3e-44 AT1G68560 1454 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10035019 [exp] 149 / 6e-43 AT1G68560 1195 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10021679 [exp] 112 / 2e-31 AT1G68560 286 / 1e-89 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10020887 [exp] 99 / 2e-25 AT5G63840 1435 / 0.0 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1) Lus10033490 [exp] 98 / 6e-25 AT5G63840 1444 / 0.0 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G442800 [exp] 177 / 3e-53 AT5G11720 1167 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.011G154500 [exp] 174 / 4e-52 AT5G11720 1215 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.011G154200 [exp] 174 / 9e-52 AT5G11720 1189 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.011G154300 [exp] 172 / 5e-51 AT5G11720 1194 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.010G125800 [exp] 152 / 4e-44 AT1G68560 1422 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Potri.008G120000 [exp] 150 / 1e-43 AT1G68560 1465 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Potri.007G100000 [exp] 95 / 5e-24 AT5G63840 1427 / 0.0 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1) Potri.005G069000 [exp] 94 / 1e-23 AT5G63840 1405 / 0.0 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1) Potri.001G129600 [exp] 86 / 1e-20 AT3G23640 1463 / 0.0 heteroglycan glucosidase 1 (.1.2) Potri.006G039500 [exp] 49 / 5e-08 AT5G63840 74 / 3e-13 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF01055 [flax] [poplar] Glyco_hydro_31 Glycosyl hydrolases family 31
Representative CDS sequence Show only first row Show all	>Lus10000778 pacid=23160150 polypeptide=Lus10000778 locus=Lus10000778.g ID=Lus10000778.BGIv1.0 annot-version=v1.0 ATGGTGGGTGCTGATATATGTGGCTTCTTATTAAACACAACGGAGGAGCTCTGCCTGCGATGGATTCAGCTGGAAGCTTTCTATCCATTTGCAAGAGACC ATTCGGACAAGAACACAATCAGGAAAGAGCTGTACGTGTGGGAATCAGTTGGTGCAGCGGCTAGAAAGGCTCTTGGACTTCGGTACAAGCTGTTACCATA TCTGTACACATTAATGGCGGAGGCACACCAGAGAGGATCTCCAATAGCAAGGCCACTCTTCTTTTCCTTCCCGGAGGATACAAACACCTACACACTCAAC TCCCAGTTTCTTCTCGGGTGA
AA sequence Show only first row Show all	>Lus10000778 pacid=23160150 polypeptide=Lus10000778 locus=Lus10000778.g ID=Lus10000778.BGIv1.0 annot-version=v1.0 MVGADICGFLLNTTEELCLRWIQLEAFYPFARDHSDKNTIRKELYVWESVGAAARKALGLRYKLLPYLYTLMAEAHQRGSPIARPLFFSFPEDTNTYTLN SQFLLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45940			Glycosyl hydrolases family 31 ...		Lus10000778 [exp]	0	1
AT1G17450			B-block binding subunit of TFI...		Lus10015660 [exp]	7.7	0.7084
AT3G03940			Protein kinase family protein ...		Lus10024261 [exp]	8.7	0.7231
AT2G28390			SAND family protein (.1)		Lus10021472 [exp]	19.2	0.6522
					Lus10019108 [exp]	35.7	0.6467
AT1G06550			ATP-dependent caseinolytic (Cl...		Lus10007334 [exp]	37.9	0.6641
AT5G66050			Wound-responsive family protei...		Lus10041852 [exp]	45.1	0.6493
AT5G17690		AtLHP1, LHP1, T...	TERMINAL FLOWER 2, LIKE HETERO...		Lus10001338 [exp]	45.3	0.6552
AT1G17450			B-block binding subunit of TFI...		Lus10015659 [exp]	47.2	0.6540
AT1G25375			Metallo-hydrolase/oxidoreducta...		Lus10005109 [exp]	54.7	0.6371
AT3G48040		ROP10, ARAC8, A...	Arabidopsis RAC-like 8, RHO-re...		Lus10034876 [exp]	59.4	0.6507

Compare expression of checked genes

Lus10000778 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.