Lus10000780 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11720 141 / 8e-39 Glycosyl hydrolases family 31 protein (.1)
AT3G45940 81 / 5e-18 Glycosyl hydrolases family 31 protein (.1)
AT1G68560 77 / 1e-16 AXY3, TRG1, XYL1, ATXYL1 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008067 281 / 5e-89 AT5G11720 1072 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Lus10038408 139 / 6e-38 AT5G11720 1150 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Lus10035019 99 / 4e-24 AT1G68560 1195 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Lus10041457 88 / 3e-20 AT1G68560 1455 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Lus10035020 87 / 5e-20 AT1G68560 1238 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Lus10034315 87 / 7e-20 AT1G68560 1454 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G442800 155 / 8e-44 AT5G11720 1167 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Potri.011G154300 154 / 2e-43 AT5G11720 1194 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Potri.011G154500 146 / 1e-40 AT5G11720 1215 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Potri.011G154200 143 / 1e-39 AT5G11720 1189 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Potri.008G120000 92 / 1e-21 AT1G68560 1465 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Potri.010G125800 91 / 3e-21 AT1G68560 1422 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
PFAM info
Representative CDS sequence
>Lus10000780 pacid=23160153 polypeptide=Lus10000780 locus=Lus10000780.g ID=Lus10000780.BGIv1.0 annot-version=v1.0
ATGGAGAGGAGAAACAAGCCATCTTCTCATCATCTCCTCCATTTCCTCATTTTCTCATCTTCATTTCTTCTTCACATTCCCTTCTATTATTCTTCAGCTG
CAGAACAAGTAGTAGGCTATGGAGTTACGAACTCCTTGACCGCCGATCTTAATCTTATCCAAACGTCCTCTCTTTACGGACCTGACATTCCCACTCTCAC
CTTCTCCGCCTGCTTTGATACGGAGAAGCAACTGCGGATTCGAATCTCCGATCCCGAAACCGCCAGATGGGAGATCACGGGACAAATCATTAACCGCCGC
CCGAGAGGCCACGGCGTCATGCTGCAGGAAGACACCGGAGTCTTCTCCCACCCGCGTTCCGACCTCGTCTTCGCCATCCAGAACACCGAGCCTTTCGGAT
TTACCGTCTCCAGGAAGTCCGACGGCGATGTCTTGTTCGATTCCTCCGTGGAAGGCTCCGAATCGTCCACCTACCTAGTATTCAAGGACCAGTACATCCA
GCTGTCTTCGAAGCTCCCTGGGAATCGATCTTCAATCTACGGCCTAGGGAGCATACCAAGCCCGATTTTAAGTTGA
AA sequence
>Lus10000780 pacid=23160153 polypeptide=Lus10000780 locus=Lus10000780.g ID=Lus10000780.BGIv1.0 annot-version=v1.0
MERRNKPSSHHLLHFLIFSSSFLLHIPFYYSSAAEQVVGYGVTNSLTADLNLIQTSSLYGPDIPTLTFSACFDTEKQLRIRISDPETARWEITGQIINRR
PRGHGVMLQEDTGVFSHPRSDLVFAIQNTEPFGFTVSRKSDGDVLFDSSVEGSESSTYLVFKDQYIQLSSKLPGNRSSIYGLGSIPSPILS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11720 Glycosyl hydrolases family 31 ... Lus10000780 0 1
AT5G28350 Quinoprotein amine dehydrogena... Lus10018824 10.3 0.8537
AT1G58250 SAB SABRE, Golgi-body localisation... Lus10024282 21.6 0.8443
AT5G07740 actin binding (.1) Lus10015724 25.8 0.8378
AT5G22780 Adaptor protein complex AP-2, ... Lus10019520 27.7 0.8225
AT2G19950 GC1 golgin candidate 1 (.1.2) Lus10034941 29.2 0.8245
AT3G47890 Ubiquitin carboxyl-terminal hy... Lus10008630 30.5 0.8372
AT2G28520 VHA-A1 vacuolar proton ATPase A1 (.1) Lus10036133 31.0 0.8314
AT5G19390 Rho GTPase activation protein ... Lus10036048 32.9 0.8336
AT1G49040 SCD1 STOMATAL CYTOKINESIS-DEFECTIVE... Lus10040449 38.9 0.8222
AT1G10130 ATECA3, ECA3 ARABIDOPSIS THALIANA ER-TYPE C... Lus10018668 40.1 0.8165

Lus10000780 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.