Lus10000784 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003830 90 / 4e-24 ND /
Lus10030123 86 / 2e-21 ND /
Lus10021744 84 / 3e-21 ND /
Lus10033028 76 / 5e-17 ND /
Lus10012674 69 / 7e-16 ND /
Lus10039431 71 / 2e-15 ND /
Lus10022940 66 / 5e-14 ND /
Lus10036316 62 / 6e-12 ND 42 / 4e-04
Lus10001874 54 / 2e-09 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000784 pacid=23180903 polypeptide=Lus10000784 locus=Lus10000784.g ID=Lus10000784.BGIv1.0 annot-version=v1.0
ATGGAGGCAAAGCTTGCTGAGAAGGATGCTAAGATTGAAGTTGCTCATACTGAGATGGAAGCTGCTCGTGCTGAATGGGCAGTAGAGAGGGCATGCATCA
TAAGGTGTAAGGATAGGTATACAGATGCTCTTACAAAAGAGTTGAGGGATGTACGACTTAAGCTTAGGCGGAGAAGGAGGTCTCCCATTGCAGCGGACCC
AACAACGATGATGTCGCGGTTGACAACGAGGTTGAAGACGAGGCTGAGTACAAGCCTGAAAACAACAATGGGGATGGATGACGACGGTACGCCAATTGGC
CCTCTCAATCCAGAGGGGGATGATGCTTATGTCATAATCGGAGAAGGAGCTGCATCATCATCTCGTCTCCCCTCACATGACTACACTCCATCCGAGTTTT
ACACAACTTTGGCAGACAACATCGATGAGGTGATGTCTGTGGACCATTAG
AA sequence
>Lus10000784 pacid=23180903 polypeptide=Lus10000784 locus=Lus10000784.g ID=Lus10000784.BGIv1.0 annot-version=v1.0
MEAKLAEKDAKIEVAHTEMEAARAEWAVERACIIRCKDRYTDALTKELRDVRLKLRRRRRSPIAADPTTMMSRLTTRLKTRLSTSLKTTMGMDDDGTPIG
PLNPEGDDAYVIIGEGAASSSRLPSHDYTPSEFYTTLADNIDEVMSVDH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000784 0 1
Lus10005396 2.8 1.0000
Lus10003840 5.1 1.0000
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10001431 6.2 1.0000
Lus10022573 7.2 1.0000
Lus10006661 8.1 1.0000
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Lus10009378 8.8 1.0000
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10038264 9.5 1.0000
Lus10012429 10.2 1.0000
AT2G29990 NDA2 alternative NAD(P)H dehydrogen... Lus10018249 10.2 0.9003
AT5G14400 CYP724A1 "cytochrome P450, family 724, ... Lus10003650 10.8 1.0000

Lus10000784 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.