Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53880 36 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G398700 [exp] 37 / 3e-05 AT5G53880 45 / 2e-08 unknown protein Potri.011G117001 [exp] 34 / 0.0003 AT5G53880 45 / 1e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000796 pacid=23157496 polypeptide=Lus10000796 locus=Lus10000796.g ID=Lus10000796.BGIv1.0 annot-version=v1.0 ATGAAGTTTCTGTTCCAGTGCCCGTGTTGCTCTTGTTTCTGCTTCATGAAGCCTAAAGCAGGAAAGCCAAAAGTCAAGAAGGAAGCTGCAGCCAAGGTTA CTGAAACTCCCAAGGTAGTAGAGGAACCTCCTGTGGCTGATGCTCCTCTTCCTCCTGCTGCATCTAAAGAAGAAAAACAGGAGTGA
AA sequence Show only first row Show all	>Lus10000796 pacid=23157496 polypeptide=Lus10000796 locus=Lus10000796.g ID=Lus10000796.BGIv1.0 annot-version=v1.0 MKFLFQCPCCSCFCFMKPKAGKPKVKKEAAAKVTETPKVVEEPPVADAPLPPAASKEEKQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53880			unknown protein		Lus10000796 [exp]	0	1
AT3G12610		DRT100	DNA-DAMAGE REPAIR/TOLERATION 1...		Lus10037705 [exp]	3.0	0.8942
AT2G16850		PIP3B, PIP2;8	PLASMA MEMBRANE INTRINSIC PROT...		Lus10039222 [exp]	4.1	0.9212
AT2G17650			AMP-dependent synthetase and l...		Lus10041826 [exp]	5.3	0.9028
AT3G12610		DRT100	DNA-DAMAGE REPAIR/TOLERATION 1...		Lus10015700 [exp]	6.0	0.8817
AT2G17650			AMP-dependent synthetase and l...		Lus10041825 [exp]	7.7	0.8925
AT5G13460		IQD11	IQ-domain 11 (.1)		Lus10039573 [exp]	13.0	0.8752
AT2G16850		PIP3B, PIP2;8	PLASMA MEMBRANE INTRINSIC PROT...		Lus10027467 [exp]	13.1	0.8814
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10024833 [exp]	15.0	0.8340
AT1G60010			unknown protein		Lus10010708 [exp]	16.0	0.8814
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	18.6	0.8898

Compare expression of checked genes

Lus10000796 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.