Lus10000799 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16195 55 / 7e-10 Plant self-incompatibility protein S1 family (.1)
AT5G12060 54 / 9e-10 Plant self-incompatibility protein S1 family (.1)
AT3G26880 47 / 2e-07 Plant self-incompatibility protein S1 family (.1)
AT5G12070 47 / 5e-07 Plant self-incompatibility protein S1 family (.1)
AT3G17080 45 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT3G16970 45 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT1G04645 44 / 3e-06 Plant self-incompatibility protein S1 family (.1)
AT4G29035 42 / 3e-05 Plant self-incompatibility protein S1 family (.1)
AT5G04350 40 / 9e-05 Plant self-incompatibility protein S1 family (.1)
AT4G16295 40 / 0.0001 SPH1 S-protein homologue 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011897 69 / 2e-15 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10002747 67 / 4e-15 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10016329 67 / 1e-14 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10023196 67 / 1e-14 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1)
Lus10023085 64 / 7e-14 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10023195 64 / 1e-13 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10023194 64 / 1e-13 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1)
Lus10018785 62 / 6e-13 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1)
Lus10022826 62 / 8e-13 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G148630 54 / 1e-09 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.016G066900 52 / 7e-09 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 50 / 2e-08 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.010G008300 50 / 2e-08 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 49 / 6e-08 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 44 / 5e-06 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 44 / 5e-06 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.015G130300 44 / 6e-06 AT3G17080 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
Potri.017G144361 39 / 0.0004 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10000799 pacid=23146029 polypeptide=Lus10000799 locus=Lus10000799.g ID=Lus10000799.BGIv1.0 annot-version=v1.0
ATGGTTATCCCCACGAGGAAATCAACTTTAGCAACATCGGTAATTCTTCTCCAATCAAAGGTGATTACTATCAGCATCATCATCATCATCATGGTTGGTC
CCACAAGGGCCAATTGGGTCTCAGTCACCAATAACTTAACCAGCCACCTTATTGTGATAGCACACTGCCGGTCGGCCGATGATGACATCAAAGCGCAACT
CCTCCCCGCCGGTGAGGAGATGCGATGGGATTTCAGACCGCGGTGGTTCGGAACCACGCACTTCTGGTGTCACGTGACCGTGCAGGACAAGCGTCTCAGT
TTTGTTGCGTATGATCAAGCTAGAGACGTACTACACTCCGACTATGTCTATGGTATAGTTATGAATGATGGGGTTCACTTGAAGTACTATGATTTTTACA
ATGGAACTTGGCAATTTGACTTTACTGCATGGAACCCTTCATTAATTAATTAA
AA sequence
>Lus10000799 pacid=23146029 polypeptide=Lus10000799 locus=Lus10000799.g ID=Lus10000799.BGIv1.0 annot-version=v1.0
MVIPTRKSTLATSVILLQSKVITISIIIIIMVGPTRANWVSVTNNLTSHLIVIAHCRSADDDIKAQLLPAGEEMRWDFRPRWFGTTHFWCHVTVQDKRLS
FVAYDQARDVLHSDYVYGIVMNDGVHLKYYDFYNGTWQFDFTAWNPSLIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G12060 Plant self-incompatibility pro... Lus10000799 0 1
AT3G16180 Major facilitator superfamily ... Lus10009506 4.5 0.8773
Lus10033149 6.3 0.8773
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 7.7 0.8773
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 8.9 0.8773
AT3G14040 Pectin lyase-like superfamily ... Lus10023364 10.0 0.8773
AT1G29430 SAUR-like auxin-responsive pro... Lus10020441 11.0 0.8773
AT1G70690 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN ... Lus10019334 11.8 0.8773
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027028 12.6 0.8773
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 13.4 0.8773
AT1G75660 AtXRN3, XRN3 5'-3' exoribonuclease 3 (.1) Lus10005213 13.8 0.8674

Lus10000799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.