Lus10000804 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21350 120 / 3e-33 PUB8, B80 plant U-box 8 (.1)
AT3G01400 47 / 1e-06 ARM repeat superfamily protein (.1)
AT5G58680 44 / 2e-05 ARM repeat superfamily protein (.1)
AT3G54790 39 / 0.0007 ARM repeat superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020077 195 / 5e-62 AT4G21350 413 / 6e-144 plant U-box 8 (.1)
Lus10006747 192 / 8e-61 AT4G21350 405 / 6e-141 plant U-box 8 (.1)
Lus10007738 45 / 6e-06 AT3G01400 555 / 0.0 ARM repeat superfamily protein (.1)
Lus10012260 45 / 7e-06 AT5G42340 695 / 0.0 Plant U-Box 15 (.1)
Lus10018684 45 / 7e-06 AT3G01400 358 / 2e-124 ARM repeat superfamily protein (.1)
Lus10016016 44 / 2e-05 AT5G42340 702 / 0.0 Plant U-Box 15 (.1)
Lus10019308 40 / 0.0003 AT2G23140 911 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Lus10011514 40 / 0.0003 AT2G23140 916 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G028800 129 / 2e-36 AT4G21350 379 / 8e-131 plant U-box 8 (.1)
Potri.011G033300 117 / 4e-32 AT4G21350 405 / 7e-141 plant U-box 8 (.1)
Potri.014G016400 45 / 8e-06 AT3G01400 557 / 0.0 ARM repeat superfamily protein (.1)
Potri.007G051000 40 / 0.0003 AT2G23140 1018 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
PFAM info
Representative CDS sequence
>Lus10000804 pacid=23175267 polypeptide=Lus10000804 locus=Lus10000804.g ID=Lus10000804.BGIv1.0 annot-version=v1.0
ATGCTCACAAAATCCTCCCCTTCCCTCTGCCGCCCCGTCACCAAATTCGGCGCCATTTCCTCCATTCTCTACTGCGTCGATTCCTCAATTTCCCCGCCTA
TCCTTGAAAAGGCCCTCTCTTTACTCCTAAACCTCTCTTTAGACGATGATAGCAAGGTGGGTTTGGTTGTGGAAGGGGCAATCGGTAGAGTAATTAGAGT
TTCGCAGTCTGGTACGCCCGATTGCAGAGTGATCGGTTGTACGATTCTCACAAGCTTGGCTGTCGTAGAGGTGAATAAGGCGACGATCAAGGACTATCCC
AACGCGATTCAATCACTGGTGAATTTGTTGGAGGTCGGGAAAGGGAGGGAGATTAAAGAAGGGGTGGCTGTGTTGTACGCGATCTGTTCATTTCCGGAAA
CCGGAGGAAAGCGGTGGAGTGCGGCTCGGTTCTTATTTTGGTCCGGTTGGTTTATAACGGGATGGAAAGAGTTGTGA
AA sequence
>Lus10000804 pacid=23175267 polypeptide=Lus10000804 locus=Lus10000804.g ID=Lus10000804.BGIv1.0 annot-version=v1.0
MLTKSSPSLCRPVTKFGAISSILYCVDSSISPPILEKALSLLLNLSLDDDSKVGLVVEGAIGRVIRVSQSGTPDCRVIGCTILTSLAVVEVNKATIKDYP
NAIQSLVNLLEVGKGREIKEGVAVLYAICSFPETGGKRWSAARFLFWSGWFITGWKEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21350 PUB8, B80 plant U-box 8 (.1) Lus10000804 0 1
AT5G19980 GONST4 golgi nucleotide sugar transpo... Lus10017141 2.6 0.8527
AT1G35190 2-oxoglutarate (2OG) and Fe(II... Lus10012963 4.5 0.7492
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Lus10019446 5.7 0.8079
AT1G13950 EIF5A, ATELF5A-... eukaryotic elongation factor 5... Lus10030422 7.1 0.7955
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Lus10043300 7.7 0.7776
AT1G57680 unknown protein Lus10028891 8.7 0.7593
AT4G01370 ATMPK4 MAP kinase 4 (.1) Lus10007921 9.4 0.7726
AT5G19980 GONST4 golgi nucleotide sugar transpo... Lus10018311 10.5 0.7778
AT5G43980 PDLP1, PDLP1A PLASMODESMATA-LOCATED PROTEIN ... Lus10001418 15.0 0.7914
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Lus10019448 17.3 0.7742

Lus10000804 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.