Plant FIBer expression Database

Lus10000805 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27220 40 / 5e-05 paired amphipathic helix repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034068
[exp]
96 / 2e-24 AT1G47480 192 / 9e-58 alpha/beta-Hydrolases superfamily protein (.1)
Lus10004639
[exp]
89 / 4e-22 AT1G69160 55 / 4e-08 unknown protein
Lus10026940
[exp]
75 / 8e-17 AT4G17510 327 / 4e-108 ubiquitin C-terminal hydrolase 3 (.1)
Lus10037909
[exp]
72 / 2e-16 ND 38 / 0.002
Lus10005297
[exp]
69 / 2e-16 ND 40 / 5e-05
Lus10014532
[exp]
61 / 4e-12 AT1G23850 78 / 2e-16 unknown protein
Lus10027494
[exp]
51 / 2e-09 ND 34 / 0.006
Lus10032430
[exp]
51 / 1e-08 AT5G42020 1033 / 0.0 luminal binding protein, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2)
Lus10043127
[exp]
48 / 2e-07 AT5G46740 362 / 2e-115 ubiquitin-specific protease 21 (.1)
Poplar homologues

No hit found
PFAM info
Representative CDS sequence
>Lus10000805 pacid=23175377 polypeptide=Lus10000805 locus=Lus10000805.g ID=Lus10000805.BGIv1.0 annot-version=v1.0
ATGAATGAAGCAGAAGGTGAGGCACTACTAACGGCCATGGAATGGGTCAGGGATATCGGCTACGAGCGATGTATCTTCGAAACCGACAATCAGTTGGTAG
CCATGGCAGTTAATGGATCGATTATCAATTTGTCAGAATTTGGTACTACAGTTGCTGTATGCCAGCAGTTGTTGCATGATAACACTCACTACAAAGTGCG
CTGGGTTAGGAGAAGTAGAAATGAGGTCACGAATGAGTTCACTCGTCGCTCTCATCACCTTGTGTCTACCGTTCAGGGTGTGACACCTCCTTCATGGTGT
GATCTTTTTGTAAACAATATTTTTCTCCAAGAATAA
AA sequence
>Lus10000805 pacid=23175377 polypeptide=Lus10000805 locus=Lus10000805.g ID=Lus10000805.BGIv1.0 annot-version=v1.0
MNEAEGEALLTAMEWVRDIGYERCIFETDNQLVAMAVNGSIINLSEFGTTVAVCQQLLHDNTHYKVRWVRRSRNEVTNEFTRRSHHLVSTVQGVTPPSWC
DLFVNNIFLQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G27220 paired amphipathic helix repea... Lus10000805
[exp]
0 1
Lus10033096
[exp]
1.4 1.0000
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10030286
[exp]
1.7 1.0000
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10021338
[exp]
2.4 1.0000
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Lus10010229
[exp]
2.8 0.9928
AT3G44150 unknown protein Lus10021005
[exp]
3.9 0.9835
AT1G02335 GL22 germin-like protein subfamily ... Lus10004855
[exp]
3.9 0.8835
AT3G26040 HXXXD-type acyl-transferase fa... Lus10004438
[exp]
4.2 0.9723
AT5G63920 TOP3A, AtTOP3al... topoisomerase 3alpha (.1) Lus10006779
[exp]
4.6 0.9795
AT4G33280 B3 REM16 AP2/B3-like transcriptional fa... Lus10016285
[exp]
4.7 0.9475
AT1G31450 Eukaryotic aspartyl protease f... Lus10002630
[exp]
4.9 0.9817

Lus10000805 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.