Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000811 [exp] 183 / 3e-57 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G111100 [exp] 44 / 7e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000810 pacid=23162247 polypeptide=Lus10000810 locus=Lus10000810.g ID=Lus10000810.BGIv1.0 annot-version=v1.0 ATGGCTGCTGCTCCAAATCTCATTTCCCAGCCATGGACGACGCCGGTTTCTGATCTCGATGTTTACGGCAGAAGAAACGGCGCCCTTTCAGGAGGATACT TGTTATTCTCCATTACAGAGAGAAGAAGAAGAAGAAGAAGATCAAAGGGTTTGAAGATCATCACTCTTTCTGCTGACGACCCATCTTACAGTTCGGGTCG GAAGAAGAAGAAATGCGGTGACTCGATCTCTGATGAGAAAAAGAAGCGACCTTTATGGAAGAAGATTGTGTTTTCTTCTAAGAAGTTAAGGAGTGTATTG CTGCTGAATGTTGTCGCTGTTGTCTACGGTGTTGGGTTTGCTTGTTGCTTCTGA
AA sequence Show only first row Show all	>Lus10000810 pacid=23162247 polypeptide=Lus10000810 locus=Lus10000810.g ID=Lus10000810.BGIv1.0 annot-version=v1.0 MAAAPNLISQPWTTPVSDLDVYGRRNGALSGGYLLFSITERRRRRRRSKGLKIITLSADDPSYSSGRKKKKCGDSISDEKKKRPLWKKIVFSSKKLRSVL LLNVVAVVYGVGFACCF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000810 [exp]	0	1
AT4G00710		BSK3	BR-signaling kinase 3 (.1)		Lus10000806 [exp]	3.7	0.7188
					Lus10000811 [exp]	7.0	0.7516
AT5G06440			unknown protein		Lus10013601 [exp]	9.9	0.6650
					Lus10040651 [exp]	11.0	0.6442
AT3G01650		RGLG1	RING domain ligase1 (.1)		Lus10003654 [exp]	21.0	0.6397
AT2G03620		AtMRS2-5, AtMGT...	magnesium transporter 3 (.1.2)		Lus10036901 [exp]	23.9	0.5897
AT3G61960			Protein kinase superfamily pro...		Lus10030182 [exp]	31.2	0.6028
AT1G08490		ATSUFS, SUFS, A...	chloroplastic NIFS-like cystei...		Lus10031670 [exp]	32.8	0.5785
AT4G29940	HD	PRHA	pathogenesis related homeodoma...		Lus10015536 [exp]	34.9	0.6056
AT3G16560			Protein phosphatase 2C family ...		Lus10004793 [exp]	35.3	0.6072

Compare expression of checked genes

Lus10000810 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.