Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05440 131 / 2e-38 EDA35 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027954 [exp] 211 / 3e-69 AT4G05440 419 / 1e-147 embryo sac development arrest 35, temperature sensing protein-related (.1.2) Lus10006898 [exp] 205 / 6e-67 AT4G05440 418 / 4e-147 embryo sac development arrest 35, temperature sensing protein-related (.1.2) Lus10027955 [exp] 193 / 3e-65 AT4G05440 132 / 6e-39 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G048600 [exp] 145 / 1e-43 AT4G05440 404 / 6e-141 embryo sac development arrest 35, temperature sensing protein-related (.1.2) Potri.007G112300 [exp] 144 / 2e-43 AT4G05440 390 / 3e-136 embryo sac development arrest 35, temperature sensing protein-related (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0179 [flax] [poplar] ATP-grasp PF07065 [flax] [poplar] D123 D123
Representative CDS sequence Show only first row Show all	>Lus10000812 pacid=23181267 polypeptide=Lus10000812 locus=Lus10000812.g ID=Lus10000812.BGIv1.0 annot-version=v1.0 ATGGAATTCTTCGAAAAGAAGGTACAGTTGCAGTTCGAATCAGACAATTACACATTTGATGTCTATGTCACCAACGCCGGGCGTGTGAAGATTATGGATT TTAACCCTTGGGGTGCATTTACACTGCCACTGCTCTTTACGTGGGAGGAACTCGAGCAAGTTACAGGGGAAGAGCTAGATGATGATGATAATGACGATGG TGTGGAGTTGAGAGTTGTGGAGACTCGGTGTGGAATTCGGCCCGGGTTAAAAACAGCAGTTCCACAGGAGTTCCTCGACGCTGACCCAGGGAGTGGATGG GAGCTGGTCTTGAAGAACGCATTTGAGGAGCAGCAGCAGAACGCACAAGTATCAGACGATGTTTGA
AA sequence Show only first row Show all	>Lus10000812 pacid=23181267 polypeptide=Lus10000812 locus=Lus10000812.g ID=Lus10000812.BGIv1.0 annot-version=v1.0 MEFFEKKVQLQFESDNYTFDVYVTNAGRVKIMDFNPWGAFTLPLLFTWEELEQVTGEELDDDDNDDGVELRVVETRCGIRPGLKTAVPQEFLDADPGSGW ELVLKNAFEEQQQNAQVSDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05440		EDA35	embryo sac development arrest ...		Lus10000812 [exp]	0	1
AT5G10530			Concanavalin A-like lectin pro...		Lus10020447 [exp]	1.4	0.9366
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	6.2	0.9048
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	7.4	0.8531
					Lus10027893 [exp]	8.2	0.8734
AT1G14830		DRP1C, ADL5, AD...	DYNAMIN RELATED PROTEIN 1C, AR...		Lus10043352 [exp]	9.9	0.8801
					Lus10015488 [exp]	14.1	0.8663
					Lus10023803 [exp]	15.2	0.8574
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10021539 [exp]	16.0	0.8131
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10021864 [exp]	16.4	0.8570
AT1G31660			unknown protein		Lus10027134 [exp]	20.5	0.8173

Compare expression of checked genes

Lus10000812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.