Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18480 329 / 2e-111 PGSIP6 plant glycogenin-like starch initiation protein 6 (.1) AT3G18660 113 / 9e-29 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) AT1G08990 112 / 9e-29 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1) AT1G77130 110 / 6e-28 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) AT1G54940 109 / 1e-27 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1) AT4G33330 99 / 6e-24 PGSIP3, GUX2 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) AT2G35710 86 / 2e-19 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3) AT4G16600 86 / 2e-19 Nucleotide-diphospho-sugar transferases superfamily protein (.1) AT1G60450 54 / 2e-08 ATGOLS7 galactinol synthase 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027949 [exp] 422 / 1e-148 AT5G18480 635 / 0.0 plant glycogenin-like starch initiation protein 6 (.1) Lus10033485 [exp] 114 / 3e-29 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Lus10018922 [exp] 113 / 1e-28 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Lus10028623 [exp] 110 / 7e-28 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Lus10020890 [exp] 110 / 8e-28 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Lus10021731 [exp] 96 / 8e-23 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) Lus10029932 [exp] 96 / 1e-22 AT1G54940 527 / 0.0 plant glycogenin-like starch initiation protein 4 (.1) Lus10042658 [exp] 94 / 5e-22 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) Lus10031507 [exp] 93 / 1e-21 AT1G54940 542 / 0.0 plant glycogenin-like starch initiation protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G049100 [exp] 323 / 5e-109 AT5G18480 661 / 0.0 plant glycogenin-like starch initiation protein 6 (.1) Potri.005G187900 [exp] 113 / 9e-29 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Potri.007G107200 [exp] 112 / 2e-28 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Potri.005G061600 [exp] 111 / 4e-28 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Potri.014G029900 [exp] 103 / 2e-25 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) Potri.013G022900 [exp] 99 / 5e-24 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1) Potri.005G033500 [exp] 97 / 3e-23 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1) Potri.003G076800 [exp] 97 / 3e-23 AT4G16600 633 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1) Potri.001G158000 [exp] 86 / 2e-19 AT4G16600 678 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0110 [flax] [poplar] GT-A PF01501 [flax] [poplar] Glyco_transf_8 Glycosyl transferase family 8
Representative CDS sequence Show only first row Show all	>Lus10000817 pacid=23181274 polypeptide=Lus10000817 locus=Lus10000817.g ID=Lus10000817.BGIv1.0 annot-version=v1.0 ATGAAATTAACGCAGCTATGTCTCCTGCTTGCGGTGGTCTTCCTTCACTCCGCAGCTGCGCTTCCACCGAAGAGAACCCAGAGCGCTTACGTAACCCTCT TGTACGGGGACGAATTCTTGCTGGGAGTTAGGGTTCTGGGGAAGTCGATTCGGGACACTGGATCGAAGAAAGATATGGTGGCTTTGGTCTCTGATGGCGT CTCCGACTACGCCAAGAGGCTTTTGGAGGCTGATGGGTGGATGGTAGAGACGATTAGCTTATTAGCGAATCCTAATCAGATTCGTCCAACAAGGTTTTGG GGCGTGTACACGAAGCTAAAGATCTTCAACATGACAAATTATCAGAAAGTTGGGCTTGCAAATCCGTTAAAATATCTCGATGCAGACACTATAGTGGTAA AAGACATTGAGGATCTCTTCCAGTGTAGTAAGTTTTGTGCCAACCTCAAGCATTCAGAAAGGTTGAATTCTGGAGTCATGGTGGTGGAACCATCCGAAGC TCTTTTCAATGACATGTTTGCTAAAGTGAACACAATGTATTCTTACACAGGAGGAGATCAGGGTTTCCTGAATTCATATTACCCGGACTTTCCAAATGCT CGTCTCTTTGAACCTGGTTTATCAAAAGAAGAGAGGATTTCTAGGGCTGTACCTGATTAA
AA sequence Show only first row Show all	>Lus10000817 pacid=23181274 polypeptide=Lus10000817 locus=Lus10000817.g ID=Lus10000817.BGIv1.0 annot-version=v1.0 MKLTQLCLLLAVVFLHSAAALPPKRTQSAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVALVSDGVSDYAKRLLEADGWMVETISLLANPNQIRPTRFW GVYTKLKIFNMTNYQKVGLANPLKYLDADTIVVKDIEDLFQCSKFCANLKHSERLNSGVMVVEPSEALFNDMFAKVNTMYSYTGGDQGFLNSYYPDFPNA RLFEPGLSKEERISRAVPD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18480		PGSIP6	plant glycogenin-like starch i...		Lus10000817 [exp]	0	1
AT3G48860			unknown protein		Lus10043194 [exp]	1.4	0.8673
AT1G54610			Protein kinase superfamily pro...		Lus10004144 [exp]	3.3	0.8795
AT1G31430			Pentatricopeptide repeat (PPR-...		Lus10002288 [exp]	4.2	0.8213
AT3G04240		SEC	secret agent, Tetratricopeptid...		Lus10007957 [exp]	5.0	0.8348
AT3G46220			unknown protein		Lus10004920 [exp]	5.9	0.8328
AT1G80000			CASC3/Barentsz eIF4AIII bindin...		Lus10011468 [exp]	8.1	0.8189
AT5G58100			unknown protein		Lus10008552 [exp]	8.7	0.8105
AT4G02570		AXR6, ATCUL1	AUXIN RESISTANT 6, cullin 1 (....		Lus10028917 [exp]	10.5	0.7971
AT3G17205		UPL6	ubiquitin protein ligase 6 (.1...		Lus10017098 [exp]	13.0	0.8217
AT4G10570		UBP9	ubiquitin-specific protease 9 ...		Lus10033243 [exp]	17.8	0.8332

Compare expression of checked genes

Lus10000817 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.