Lus10000822 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 87 / 2e-21 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G17140 53 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G64620 46 / 3e-06 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G17150 42 / 5e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G38610 42 / 0.0001 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027947 228 / 5e-77 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 121 / 5e-35 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 117 / 5e-33 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017013 108 / 7e-30 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017076 100 / 2e-26 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037792 99 / 3e-26 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017040 95 / 2e-24 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 87 / 2e-21 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 67 / 5e-14 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G063000 101 / 4e-27 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.009G083500 93 / 6e-24 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G102600 70 / 5e-15 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G122000 54 / 5e-09 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G109700 52 / 1e-08 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.006G134900 50 / 1e-07 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.016G001600 47 / 1e-06 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.007G108301 44 / 9e-06 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.013G012800 41 / 9e-05 ND /
Potri.001G127500 41 / 0.0002 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10000822 pacid=23181268 polypeptide=Lus10000822 locus=Lus10000822.g ID=Lus10000822.BGIv1.0 annot-version=v1.0
ATGGCGCCAAACCCAGCACAACTCACCGGCGCTCTGACCTCCGCCGCCCTCTTTCTCATCATCATAACAACAACCACCACCACCCACGCCTCCTCCTCCA
CCTTCGCCTCCGCCAGCAATCTCATCACACAAACATGCAAGCAGACCCCAGATTACAACCTCTGCGTATCCTCCCTCACCGCCGACCCCCGCGGCCCGAA
AGCAAATGACGTCCAGACCCTCGCCCTCATAATGATCGACGTAGTCAGCAACAAGGCAGCCGCAACTTCCGATGAAATCAAGCGGCTCGTTAGTAAAGGC
AATCCAGCGTTGAAGGAGCCGCTGATGGAATGCGCCGATAAGTATAAGGTCGTCGTCAATGTCGACGTCGGCGTGGCGATCAAAGCGGTGCGTATAGGGA
ACCCGGGTGCCGGAGAAGGAGCGATGAACGACGCTGGGAATAAGTCTGATTCGTGCGAGCGTGGATTTCAAGGATTGAAGTCGCCGTTGGCTGACATGAA
TCATGCTGTACGTAGCGTTGCTGATGTGGCATCGGCTATTATTAGCCTGTTGATTTGA
AA sequence
>Lus10000822 pacid=23181268 polypeptide=Lus10000822 locus=Lus10000822.g ID=Lus10000822.BGIv1.0 annot-version=v1.0
MAPNPAQLTGALTSAALFLIIITTTTTTHASSSTFASASNLITQTCKQTPDYNLCVSSLTADPRGPKANDVQTLALIMIDVVSNKAAATSDEIKRLVSKG
NPALKEPLMECADKYKVVVNVDVGVAIKAVRIGNPGAGEGAMNDAGNKSDSCERGFQGLKSPLADMNHAVRSVADVASAIISLLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10000822 0 1

Lus10000822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.