Lus10000824 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000824 pacid=23152847 polypeptide=Lus10000824 locus=Lus10000824.g ID=Lus10000824.BGIv1.0 annot-version=v1.0
ATGACCAGCTGGTGTCAGCTACTATGGGGATGCAAGAGCGGTCGCCCTTCAAATAAGCGGATGATCCATGGTTATTGGCCAACTAACTGGCAACAGCCTC
CGTATCCTCAAAGTGTATCCGGCCAGAAAACCGAGCGGCAGCTTCTGAAAGACATCGGGAGATATACAACATTTTGGGACATTGGAGTGGAATCGCCACG
GGAGATACACAACGCTGAACCCAGTGGATTACTTCCAAGAGGCCCTAGATGCTTACGACAGCTGTGA
AA sequence
>Lus10000824 pacid=23152847 polypeptide=Lus10000824 locus=Lus10000824.g ID=Lus10000824.BGIv1.0 annot-version=v1.0
MTSWCQLLWGCKSGRPSNKRMIHGYWPTNWQQPPYPQSVSGQKTERQLLKDIGRYTTFWDIGVESPREIHNAEPSGLLPRGPRCLRQL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000824 0 1
Lus10003272 1.4 1.0000
Lus10010826 2.0 1.0000
Lus10022108 2.4 1.0000
AT2G36780 UDP-Glycosyltransferase superf... Lus10023893 2.8 1.0000
AT3G47090 Leucine-rich repeat protein ki... Lus10028479 3.2 1.0000
Lus10030783 3.5 1.0000
Lus10036152 3.7 1.0000
Lus10037861 4.0 1.0000
AT1G24430 HXXXD-type acyl-transferase fa... Lus10037952 4.2 1.0000
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001033 7.6 0.8900

Lus10000824 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.