Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G13680 219 / 3e-66 GLS2, ATGSL02, CALS5 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1) AT5G13000 207 / 2e-62 CALS3, ATGSL12 callose synthase 3, glucan synthase-like 12 (.1.2) AT2G31960 202 / 1e-60 ATGSL3, ATGSL03 glucan synthase-like 3 (.1.2) AT1G05570 201 / 3e-60 ATGSL6, ATGSL06, GSL6, CALS1 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2) AT2G36850 201 / 3e-60 CHOR, ATGSL8, ATGSL08 CHORUS, glucan synthase-like 8 (.1) AT5G36870 198 / 6e-59 ATGSL9, ATGSL09 glucan synthase-like 9 (.1) AT3G07160 197 / 1e-58 CALS9, ATGSL10 glucan synthase-like 10 (.1) AT1G06490 195 / 5e-58 CalS7, ATGSL7, ATGSL07 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1) AT4G03550 195 / 6e-58 ATGSL5, PMR4, GSL5, ATGSL05 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1) AT3G59100 194 / 2e-57 ATGSL11 glucan synthase-like 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033483 [exp] 238 / 4e-74 AT2G13680 1447 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1) Lus10020893 [exp] 238 / 6e-73 AT2G13680 3037 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1) Lus10042959 [exp] 207 / 6e-62 AT3G07160 2760 / 0.0 glucan synthase-like 10 (.1) Lus10003920 [exp] 206 / 1e-61 AT1G05570 3231 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2) Lus10037469 [exp] 206 / 1e-61 AT1G05570 3143 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2) Lus10013744 [exp] 204 / 4e-61 AT1G05570 2981 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2) Lus10039199 [exp] 204 / 4e-61 AT5G13000 3524 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2) Lus10014796 [exp] 203 / 1e-60 AT2G36850 2935 / 0.0 CHORUS, glucan synthase-like 8 (.1) Lus10040891 [exp] 202 / 2e-60 AT2G36850 1124 / 0.0 CHORUS, glucan synthase-like 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G058300 [exp] 214 / 2e-64 AT2G13680 3190 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1) Potri.001G012200 [exp] 204 / 3e-61 AT5G13000 3492 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2) Potri.003G214200 [exp] 204 / 3e-61 AT5G13000 3363 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2) Potri.001G230000 [exp] 204 / 4e-61 AT5G13000 3157 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2) Potri.015G089300 [exp] 201 / 4e-60 AT2G36850 3066 / 0.0 CHORUS, glucan synthase-like 8 (.1) Potri.002G058700 [exp] 194 / 8e-58 AT1G06490 2961 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1) Potri.005G203500 [exp] 194 / 1e-57 AT1G06490 2914 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1) Potri.013G131300 [exp] 194 / 2e-57 AT4G03550 2752 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1) Potri.001G011900 [exp] 191 / 9e-57 AT3G07160 2981 / 0.0 glucan synthase-like 10 (.1) Potri.011G052400 [exp] 189 / 6e-56 AT4G04970 2583 / 0.0 GLUCAN SYNTHASE LIKE-1, GLUCAN SYNTHASE LIKE 1, glucan synthase-like 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0111 [flax] [poplar] GT-C PF02364 [flax] [poplar] Glucan_synthase 1,3-beta-glucan synthase component
Representative CDS sequence Show only first row Show all	>Lus10000831 pacid=23170692 polypeptide=Lus10000831 locus=Lus10000831.g ID=Lus10000831.BGIv1.0 annot-version=v1.0 ATGATGTATTATAGAAGAGCTCTGAAACTTCAGGTTTTCCTTGATATGGCTAATGAGAGTGCAATCCTTCTCGCATACATTGATGAAATAGAAGAACGAG ATGGGGGGAAATCACAAAAAGTGTATTACTCTGTGCTGGTCAAAGCCGTTGATAATCTCGATCAGGTGATTTTCCACATACATGGTGTCATTAAGCATCG CCTTGATTATGCCAGTGTTTCCTCTTTGGCTTGGTTCATGTCAAATCAAGAAACAAGTTTCGTCACCCTTGGTCAGAGAGTTCTTGCAAGACCTTTGAAG ATACGATTCCATTATGGGCATCCAGATGTGTTTGATAGAATTTTCCACTTAACACGTGGGGGTGTCAGCAAAGCTTCCCGTGGCATCAACTTGAGCGAGG ATATCTTTGCTGGATTCAATTCGACACTACGAAGAGGAAATATAACTCATCACGAGTACATTCAAGTCGGTAAAGGTCGAGATGTGGGGCTCAACCAAAT CTCTCTATTTGAAGCAAAAGTAGCATGA
AA sequence Show only first row Show all	>Lus10000831 pacid=23170692 polypeptide=Lus10000831 locus=Lus10000831.g ID=Lus10000831.BGIv1.0 annot-version=v1.0 MMYYRRALKLQVFLDMANESAILLAYIDEIEERDGGKSQKVYYSVLVKAVDNLDQVIFHIHGVIKHRLDYASVSSLAWFMSNQETSFVTLGQRVLARPLK IRFHYGHPDVFDRIFHLTRGGVSKASRGINLSEDIFAGFNSTLRRGNITHHEYIQVGKGRDVGLNQISLFEAKVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G13680		GLS2, ATGSL02, ...	ARABIDOPSIS THALIANA GLUCAN SY...		Lus10000831 [exp]	0	1
AT2G22530			Alkaline-phosphatase-like fami...		Lus10035939 [exp]	5.0	0.7046
AT4G00020		BRCA2(IV), BRCA...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10017785 [exp]	7.4	0.7507
AT1G67120			ATPases;nucleotide binding;ATP...		Lus10037616 [exp]	13.6	0.7226
AT1G13570			F-box/RNI-like superfamily pro...		Lus10034418 [exp]	16.0	0.7212
AT3G58590			Pentatricopeptide repeat (PPR)...		Lus10020138 [exp]	22.1	0.6738
AT5G64390		HEN4	HUA ENHANCER 4, RNA-binding KH...		Lus10028237 [exp]	23.7	0.6946
AT5G10710			unknown protein		Lus10026943 [exp]	29.9	0.6251
AT2G27590			S-adenosyl-L-methionine-depend...		Lus10020593 [exp]	36.0	0.6836
AT1G55300		TAF7	TBP-associated factor 7 (.1.2)		Lus10017011 [exp]	39.3	0.6990
AT3G09500			Ribosomal L29 family protein ...		Lus10030314 [exp]	44.1	0.6172

Compare expression of checked genes

Lus10000831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.