Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23560 87 / 1e-22 ATMES7 ARABIDOPSIS THALIANA METHYL ESTERASE 7, methyl esterase 7 (.1) AT2G23610 85 / 8e-22 ATMES3 ARABIDOPSIS THALIANA METHYL ESTERASE 3, methyl esterase 3 (.1) AT2G23600 85 / 1e-21 ATMES2, ACL, ATME8 ARABIDOPSIS THALIANA METHYL ESTERASE 2, ARABIDOPSIS METHYL ESTERASE 8, acetone-cyanohydrin lyase (.1) AT2G23580 81 / 9e-21 ATMES4, ABE4 ARABIDOPSIS THALIANA METHYL ESTERASE 4, ALPHA/BETA FOLD HYDROLASE/ESTERASE 4, methyl esterase 4 (.1.2) AT2G23590 81 / 4e-20 ATMES8 methyl esterase 8 (.1) AT2G23620 80 / 1e-19 ATMES1 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) AT4G37140 73 / 4e-18 ATMES20, MEE69 MATERNAL EFFECT EMBRYO ARREST 69, ARABIDOPSIS THALIANA METHYL ESTERASE 20, alpha/beta-Hydrolases superfamily protein (.1) AT2G23550 75 / 6e-18 ATMES6, ABE1 ALPHA/BETA FOLD HYDROLASE/ESTERASE 1, methyl esterase 6 (.1.2) AT3G50440 75 / 8e-18 ATMES10 ARABIDOPSIS THALIANA METHYL ESTERASE 10, methyl esterase 10 (.1) AT5G10300 74 / 1e-17 AtHNL, HNL, ATMES5 HYDROXYNITRILE LYASE, ARABIDOPSIS THALIANA METHYL ESTERASE 5, methyl esterase 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019645 [exp] 141 / 4e-45 AT2G23600 139 / 7e-42 ARABIDOPSIS THALIANA METHYL ESTERASE 2, ARABIDOPSIS METHYL ESTERASE 8, acetone-cyanohydrin lyase (.1) Lus10023326 [exp] 107 / 2e-30 AT3G50440 263 / 3e-88 ARABIDOPSIS THALIANA METHYL ESTERASE 10, methyl esterase 10 (.1) Lus10012854 [exp] 92 / 2e-25 AT2G23600 147 / 2e-45 ARABIDOPSIS THALIANA METHYL ESTERASE 2, ARABIDOPSIS METHYL ESTERASE 8, acetone-cyanohydrin lyase (.1) Lus10022467 [exp] 86 / 4e-22 AT3G50440 238 / 2e-78 ARABIDOPSIS THALIANA METHYL ESTERASE 10, methyl esterase 10 (.1) Lus10005400 [exp] 83 / 5e-21 AT2G23610 206 / 8e-66 ARABIDOPSIS THALIANA METHYL ESTERASE 3, methyl esterase 3 (.1) Lus10005402 [exp] 82 / 1e-20 AT2G23580 204 / 3e-65 ARABIDOPSIS THALIANA METHYL ESTERASE 4, ALPHA/BETA FOLD HYDROLASE/ESTERASE 4, methyl esterase 4 (.1.2) Lus10030707 [exp] 81 / 1e-19 AT3G29770 494 / 4e-175 ARABIDOPSIS THALIANA METHYL ESTERASE 11, methyl esterase 11 (.1) Lus10015532 [exp] 79 / 1e-19 AT2G23600 240 / 2e-79 ARABIDOPSIS THALIANA METHYL ESTERASE 2, ARABIDOPSIS METHYL ESTERASE 8, acetone-cyanohydrin lyase (.1) Lus10013193 [exp] 80 / 2e-19 AT3G29770 493 / 8e-175 ARABIDOPSIS THALIANA METHYL ESTERASE 11, methyl esterase 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G133700 [exp] 86 / 3e-22 AT2G23620 277 / 6e-94 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) Potri.007G036700 [exp] 86 / 4e-22 AT2G23610 244 / 8e-81 ARABIDOPSIS THALIANA METHYL ESTERASE 3, methyl esterase 3 (.1) Potri.005G133600 [exp] 84 / 2e-21 AT2G23620 274 / 8e-93 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) Potri.007G036800 [exp] 85 / 3e-21 AT2G23560 230 / 2e-74 ARABIDOPSIS THALIANA METHYL ESTERASE 7, methyl esterase 7 (.1) Potri.005G133800 [exp] 83 / 5e-21 AT2G23620 270 / 7e-91 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) Potri.007G037100 [exp] 81 / 2e-20 AT2G23620 235 / 1e-77 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) Potri.007G037200 [exp] 81 / 2e-20 AT2G23620 238 / 2e-78 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) Potri.007G037033 [exp] 81 / 2e-20 AT2G23620 238 / 2e-78 ARABIDOPSIS THALIANA METHYL ESTERASE 1, methyl esterase 1 (.1) Potri.011G082400 [exp] 80 / 8e-20 AT2G23590 254 / 4e-85 methyl esterase 8 (.1) Potri.009G107500 [exp] 80 / 1e-19 AT3G50440 240 / 1e-78 ARABIDOPSIS THALIANA METHYL ESTERASE 10, methyl esterase 10 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000840 pacid=23148149 polypeptide=Lus10000840 locus=Lus10000840.g ID=Lus10000840.BGIv1.0 annot-version=v1.0 ATGAAGAAACAACACTTTGTACTAGTTCATGGAACAAACCATGGAGCCTGGTGCTGGTACAAGGTCATGGCCCGGCTAGAATCAGCCGGGCACATCGTTA CAGCGTTGGACCTCGGAGGAAGTGGAGTCAACTTTGACCGAGTTTCGTCCATCTTCGACTACGTCAACCCGCTGGTTCAGTTCATGGCTGATCTGTCTGA AGATGAAGAAGAAAGAGTCAATCCTTGTGGGTCATAG
AA sequence Show only first row Show all	>Lus10000840 pacid=23148149 polypeptide=Lus10000840 locus=Lus10000840.g ID=Lus10000840.BGIv1.0 annot-version=v1.0 MKKQHFVLVHGTNHGAWCWYKVMARLESAGHIVTALDLGGSGVNFDRVSSIFDYVNPLVQFMADLSEDEEERVNPCGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23560		ATMES7	ARABIDOPSIS THALIANA METHYL ES...		Lus10000840 [exp]	0	1
AT2G23570		ATMES19	ARABIDOPSIS THALIANA METHYL ES...		Lus10000841 [exp]	3.0	0.8214
					Lus10019691 [exp]	3.7	0.8380
					Lus10007078 [exp]	11.2	0.7444
					Lus10019690 [exp]	13.3	0.8348
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10027347 [exp]	13.6	0.8155
AT4G04450	WRKY	ATWRKY42, WRKY4...	WRKY family transcription fact...		Lus10038028 [exp]	34.3	0.8111
AT2G44340			VQ motif-containing protein (....		Lus10021054 [exp]	39.9	0.7957
AT4G14990			Topoisomerase II-associated pr...		Lus10010445 [exp]	44.0	0.6794
AT3G10330			Cyclin-like family protein (.1...		Lus10016260 [exp]	44.8	0.6847
AT1G65890		AAE12	acyl activating enzyme 12 (.1)		Lus10010956 [exp]	90.0	0.7146

Compare expression of checked genes

Lus10000840 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.