Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13560 55 / 4e-10 O-Glycosyl hydrolases family 17 protein (.1.2.3) AT5G58090 52 / 5e-09 O-Glycosyl hydrolases family 17 protein (.1) AT5G20330 51 / 1e-08 BETAG4 "beta-1,3-glucanase 4", beta-1,3-glucanase 4 (.1) AT1G33220 50 / 2e-08 Glycosyl hydrolase superfamily protein (.1) AT5G20390 49 / 3e-08 Glycosyl hydrolase superfamily protein (.1) AT5G20340 49 / 3e-08 BG5 beta-1,3-glucanase 5 (.1) AT3G46570 48 / 9e-08 Glycosyl hydrolase superfamily protein (.1) AT5G20560 48 / 9e-08 Glycosyl hydrolase superfamily protein (.1) AT1G77780 48 / 1e-07 Glycosyl hydrolase superfamily protein (.1) AT3G23770 47 / 2e-07 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000844 [exp] 142 / 3e-42 AT3G07320 135 / 5e-35 O-Glycosyl hydrolases family 17 protein (.1) Lus10001183 [exp] 57 / 1e-10 AT5G20870 628 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10043075 [exp] 56 / 3e-10 AT5G20870 631 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10024535 [exp] 53 / 2e-09 AT4G31140 627 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10013465 [exp] 49 / 8e-08 AT2G01630 745 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10027859 [exp] 47 / 1e-07 AT3G57240 185 / 4e-58 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) Lus10029149 [exp] 48 / 2e-07 AT5G55180 271 / 2e-87 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10031037 [exp] 48 / 2e-07 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) Lus10014109 [exp] 47 / 2e-07 AT3G57270 361 / 1e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G216700 [exp] 58 / 2e-11 AT5G20870 633 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.002G089200 [exp] 57 / 9e-11 AT1G77780 309 / 6e-104 Glycosyl hydrolase superfamily protein (.1) Potri.005G172000 [exp] 56 / 2e-10 AT1G77780 338 / 6e-115 Glycosyl hydrolase superfamily protein (.1) Potri.003G218500 [exp] 50 / 3e-08 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.018G000900 [exp] 49 / 3e-08 AT4G31140 667 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.006G280700 [exp] 49 / 4e-08 AT4G31140 676 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.001G006500 [exp] 47 / 2e-07 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.013G059700 [exp] 47 / 3e-07 AT1G64760 701 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.002G247900 [exp] 45 / 7e-07 AT3G07320 653 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.004G202400 [exp] 45 / 7e-07 AT2G27500 540 / 0.0 Glycosyl hydrolase superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00332 [flax] [poplar] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Lus10000842 pacid=23148142 polypeptide=Lus10000842 locus=Lus10000842.g ID=Lus10000842.BGIv1.0 annot-version=v1.0 ATGGAGAAGGTCGGGGTGAAGGGGATACATGTCATCCTCGGCGAGACAGGGTGGCCAACGGACGGCCAGAGCCAGCTAGCCCATAGCGGGTACGCGGCCA CGTACACCAACAACTTGGTGGACTGGTTGAACAACAACAAGGGGACGCCGAGGAGGAGTTGGCCCACAGAGACATTTATTCGAACACTTTACGTGCAAGA CAAGTCGGGTTCGGGTGGAGATGGGTACGGGTTGTTTTTCACTAATGGGACCTCTGCAAATCCTTTTATAAAAATCACTCATTTTTAA
AA sequence Show only first row Show all	>Lus10000842 pacid=23148142 polypeptide=Lus10000842 locus=Lus10000842.g ID=Lus10000842.BGIv1.0 annot-version=v1.0 MEKVGVKGIHVILGETGWPTDGQSQLAHSGYAATYTNNLVDWLNNNKGTPRRSWPTETFIRTLYVQDKSGSGGDGYGLFFTNGTSANPFIKITHF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13560			O-Glycosyl hydrolases family 1...		Lus10000842 [exp]	0	1
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10003334 [exp]	1.0	0.8771
AT1G26140			unknown protein		Lus10034406 [exp]	9.8	0.7278
AT4G15610			Uncharacterised protein family...		Lus10033972 [exp]	12.4	0.7443
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	17.4	0.7310
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	20.1	0.7310
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	22.5	0.7310
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10036457 [exp]	24.6	0.7310
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	26.6	0.7310
AT5G24910		ELA1, CYP714A1	EUI-like p450 A1, cytochrome P...		Lus10003361 [exp]	26.8	0.6200
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	27.2	0.6701

Compare expression of checked genes

Lus10000842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.