Lus10000855 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20410 54 / 3e-09 RNA-binding ASCH domain protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028672 178 / 1e-55 AT2G20410 309 / 1e-103 RNA-binding ASCH domain protein (.1)
Lus10000969 81 / 1e-18 AT1G21580 568 / 4e-167 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1)
Lus10028660 81 / 2e-18 AT1G21580 583 / 5e-172 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1)
Lus10028671 66 / 4e-13 AT4G36090 75 / 5e-14 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1), oxidoreductase, 2OG-Fe(II) oxygenase family protein (.2), oxidoreductase, 2OG-Fe(II) oxygenase family protein (.3)
Lus10042558 52 / 9e-09 AT2G20410 306 / 4e-104 RNA-binding ASCH domain protein (.1)
Lus10022016 40 / 0.0001 AT2G20410 285 / 4e-96 RNA-binding ASCH domain protein (.1)
Lus10006580 0 / 1 AT2G20410 327 / 2e-111 RNA-binding ASCH domain protein (.1)
Lus10014656 0 / 1 AT2G20410 295 / 1e-95 RNA-binding ASCH domain protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G045800 51 / 2e-08 AT2G20410 281 / 3e-95 RNA-binding ASCH domain protein (.1)
Potri.019G017900 51 / 3e-08 AT2G20410 288 / 2e-96 RNA-binding ASCH domain protein (.1)
PFAM info
Representative CDS sequence
>Lus10000855 pacid=23173569 polypeptide=Lus10000855 locus=Lus10000855.g ID=Lus10000855.BGIv1.0 annot-version=v1.0
ATGAATCATTCTGCGTACTATGAGTCTGATAACAAACCTAGAGGAAGAGGTAAAGAGAATTCTTATTCAGGACGAGGCACAAAAGATCAAGCTGGAGGTG
GAACTCCTGTTGTTACACCTGATCTACCAGCCTCTGTGAGTTCGTCTGATGGAGGTTTGAATCCTTGGAAGAGTAAAGTTAGGAAACTGGACATTTCTGA
TCGGAAGGATAGTTTGAGCCCCCACCCGATGAACTTCAACCCCTGCTTGACTATGCACCAACCTTGGGCTTCTCTGCTCGTCCACAGCATTAAACGGATC
GAAGGCGATCCTGGCCGGCTCCCGTTCGCGAGTGTTTCAGGCATCGATGATGGAGGAAATCACAAAAACTGGATCGCTACAAGAATCCATGGCTTGAGTT
GA
AA sequence
>Lus10000855 pacid=23173569 polypeptide=Lus10000855 locus=Lus10000855.g ID=Lus10000855.BGIv1.0 annot-version=v1.0
MNHSAYYESDNKPRGRGKENSYSGRGTKDQAGGGTPVVTPDLPASVSSSDGGLNPWKSKVRKLDISDRKDSLSPHPMNFNPCLTMHQPWASLLVHSIKRI
EGDPGRLPFASVSGIDDGGNHKNWIATRIHGLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20410 RNA-binding ASCH domain protei... Lus10000855 0 1
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039426 3.5 0.7369
AT4G01410 Late embryogenesis abundant (L... Lus10012605 5.8 0.7924
AT5G61730 ABCA9, ATATH11 ARABIDOPSIS THALIANA ABC2 HOMO... Lus10042172 9.8 0.6715
Lus10011723 16.9 0.7139
AT3G23880 F-box and associated interacti... Lus10010910 20.1 0.7077
Lus10024552 22.7 0.7076
Lus10022573 25.3 0.7074
Lus10003840 27.4 0.7074
Lus10005396 29.3 0.7074
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10001431 31.0 0.7074

Lus10000855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.