Lus10000859 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028679 115 / 1e-31 AT5G61890 130 / 1e-35 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G195000 53 / 4e-09 AT5G50080 108 / 5e-27 ethylene response factor 110 (.1)
Potri.002G065600 39 / 0.0003 AT5G50080 88 / 6e-20 ethylene response factor 110 (.1)
PFAM info
Representative CDS sequence
>Lus10000859 pacid=23173567 polypeptide=Lus10000859 locus=Lus10000859.g ID=Lus10000859.BGIv1.0 annot-version=v1.0
ATGAGGGATTACTGGCAGTACTCGCAGTTACTGCAAAGCTCCGGCGAGTTTCAGGCGTGCCAGCAGCCTCCGACTTTGTTGGAGCAATTGTTGTACACCT
CGCAGCAGGCTCCTCCGGTGCAGTCTTTGCCGTTGCCGTCGACGACTTCTCCGCCGTCAATTCGAGCTCCTCCTTCTTCTACTACCTCATTTCCCTTGCT
TTTTGCCGGTCAGCAGCAACCCGGTTACTCCCGGCCGAATCAGAATCCTGACCCGACTCAGAACCCGAACCGGAATCCGACGGCCGGTTCAGATTTTCCG
GTGCCGCCATGGTCACATTCTTCTAGTAATTATCCTCCGTCTTCTAGTTGA
AA sequence
>Lus10000859 pacid=23173567 polypeptide=Lus10000859 locus=Lus10000859.g ID=Lus10000859.BGIv1.0 annot-version=v1.0
MRDYWQYSQLLQSSGEFQACQQPPTLLEQLLYTSQQAPPVQSLPLPSTTSPPSIRAPPSSTTSFPLLFAGQQQPGYSRPNQNPDPTQNPNRNPTAGSDFP
VPPWSHSSSNYPPSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000859 0 1
AT1G60690 NAD(P)-linked oxidoreductase s... Lus10006105 2.2 0.9849
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10034838 2.8 0.9855
AT4G04450 WRKY ATWRKY42, WRKY4... WRKY family transcription fact... Lus10015546 3.2 0.9896
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10035480 4.2 0.9829
AT4G35180 LHT7 LYS/HIS transporter 7 (.1) Lus10022642 5.5 0.9848
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10035479 6.5 0.9790
Lus10000858 6.9 0.9839
AT2G15480 UGT73B5 UDP-glucosyl transferase 73B5 ... Lus10019833 7.2 0.9850
Lus10041163 8.7 0.9852
Lus10027919 8.9 0.9801

Lus10000859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.