Lus10000883 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21610 203 / 7e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT1G67600 177 / 1e-57 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 172 / 2e-55 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G61770 100 / 2e-26 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 67 / 3e-14 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003670 296 / 4e-104 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10035299 190 / 3e-62 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 183 / 6e-59 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10011373 163 / 6e-52 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10006432 162 / 1e-51 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 125 / 8e-38 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10030253 98 / 1e-26 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 66 / 5e-13 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 65 / 5e-13 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G087100 247 / 5e-85 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 176 / 6e-57 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.010G056600 176 / 8e-57 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.014G156000 171 / 7e-55 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G171300 104 / 9e-28 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 56 / 6e-10 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10000883 pacid=23162082 polypeptide=Lus10000883 locus=Lus10000883.g ID=Lus10000883.BGIv1.0 annot-version=v1.0
ATGAACGAAGTCATCACAGCTGCTGATGTATCAGCGAGGTTCCGATCAGCCGCATCTCAGCCCTCCATCATCCCTTCTAATGTCCCACTCGTCACCGCCT
TCCTCGCATTAGCTATCGCCCAGTTCCTCAAACCTTTTACCGTCTGGTTTAAGGAGAGAAGATGGGATTCTCGAAGGATGCTTGGATCTGGTGGAATGCC
CTCCTCACATTCCGCAACAGTGACAGCACTTGCTGTGGCTATTGCACTGCAGGAAGGAACTGGGGCACCAACTTTTGCTGTTGCATTGGTTTTGGCTTGC
GTTGTTATGTATGATGCTACTGGTGTTAGACTTCATGCTGGCCGGCAGGCTGAGTTATTGAATCAAATAGTGTGCGAGCTGCCTCCTGAACATCCTGTCT
CCAATTGTAGACCACTTCGGGATAGCCTTGGTCATACTCCCATCCAGGTTTGTTGCGCTCTCACTGTTCCCGATTTGAAGTAA
AA sequence
>Lus10000883 pacid=23162082 polypeptide=Lus10000883 locus=Lus10000883.g ID=Lus10000883.BGIv1.0 annot-version=v1.0
MNEVITAADVSARFRSAASQPSIIPSNVPLVTAFLALAIAQFLKPFTVWFKERRWDSRRMLGSGGMPSSHSATVTALAVAIALQEGTGAPTFAVALVLAC
VVMYDATGVRLHAGRQAELLNQIVCELPPEHPVSNCRPLRDSLGHTPIQVCCALTVPDLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21610 Acid phosphatase/vanadium-depe... Lus10000883 0 1
AT4G11740 SAY1 Ubiquitin-like superfamily pro... Lus10029591 4.9 0.8759
AT2G45010 PLAC8 family protein (.1.2) Lus10038926 7.1 0.8585
AT1G07360 C3HZnF MAC5A MOS4-associated complex subuni... Lus10020512 7.1 0.8367
AT4G28610 GARP ATPHR1, PHR1 phosphate starvation response ... Lus10022886 8.7 0.8275
AT5G14540 Protein of unknown function (D... Lus10032138 8.9 0.8633
AT1G14650 SWAP (Suppressor-of-White-APri... Lus10013966 12.2 0.8057
AT5G54650 ATFH5, Fh5 FORMIN HOMOLOGY 5, formin homo... Lus10035827 13.3 0.8530
AT5G49610 F-box family protein (.1) Lus10028682 18.3 0.8479
AT2G01190 PDE331 PIGMENT DEFECTIVE 331, Octicos... Lus10013486 19.0 0.8260
AT5G07270 XBAT33 XB3 ortholog 3 in Arabidopsis ... Lus10027441 19.3 0.8037

Lus10000883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.