Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029589 [exp] 87 / 6e-21 AT5G02930 71 / 5e-13 F-box/RNI-like superfamily protein (.1) Lus10014141 [exp] 79 / 4e-18 AT3G18150 70 / 5e-13 RNI-like superfamily protein (.1) Lus10023039 [exp] 72 / 5e-16 AT1G60400 59 / 4e-10 F-box/RNI-like superfamily protein (.1) Lus10029586 [exp] 69 / 1e-14 AT3G18150 78 / 2e-15 RNI-like superfamily protein (.1) Lus10029587 [exp] 66 / 2e-13 AT5G02930 74 / 3e-14 F-box/RNI-like superfamily protein (.1) Lus10006318 [exp] 61 / 9e-12 AT1G69630 74 / 9e-14 F-box/RNI-like superfamily protein (.1) Lus10035362 [exp] 55 / 8e-11 ND / Lus10014140 [exp] 54 / 2e-10 ND 36 / 0.002 Lus10032433 [exp] 57 / 3e-10 ND 50 / 6e-08
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G104300 [exp] 38 / 0.0008 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000890 pacid=23165399 polypeptide=Lus10000890 locus=Lus10000890.g ID=Lus10000890.BGIv1.0 annot-version=v1.0 ATGCTTACCCGTCCGTCCCTTATTCATGCTTATGTTCGAGGTGATTGTTTGGAATCTTTTTATGGGGGTGATTATTATGACCAAGTATCTCTTGGCTTCT TGTTTCGTGCTCTACGTAACGTAGAGTTTCTGAGGCTATCCATTGCTATCAGCATGGCCATGTGTGAAATTCCAGGTTCTCTAGATGAACAACCTTCGCC TTTTACGAAATTGAAGAAGTTAAATTTGGAGTATGCGTTCGAAGCAGAGATACCTTGCATGGCTCTGGATAAGTACTTGAAGTATTTTTTTAATCAATCT CTTAATGATGCTGGCCTAGACATCCAAATTAGGAAGAAGAAACCATGTAGGTGGGAAGTAACGATTGAGCGTTTACCCTGA
AA sequence Show only first row Show all	>Lus10000890 pacid=23165399 polypeptide=Lus10000890 locus=Lus10000890.g ID=Lus10000890.BGIv1.0 annot-version=v1.0 MLTRPSLIHAYVRGDCLESFYGGDYYDQVSLGFLFRALRNVEFLRLSIAISMAMCEIPGSLDEQPSPFTKLKKLNLEYAFEAEIPCMALDKYLKYFFNQS LNDAGLDIQIRKKKPCRWEVTIERLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000890 [exp]	0	1
					Lus10012132 [exp]	3.2	0.8824
					Lus10010271 [exp]	5.7	0.8647
AT3G07840			Pectin lyase-like superfamily ...		Lus10011030 [exp]	6.2	0.8480
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10035526 [exp]	6.5	0.8017
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10027514 [exp]	10.1	0.8093
					Lus10041755 [exp]	12.3	0.7686
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Lus10040300 [exp]	14.4	0.8242
AT2G37890			Mitochondrial substrate carrie...		Lus10036193 [exp]	20.4	0.7584
					Lus10025017 [exp]	21.6	0.7400
AT3G07960		PIP5K6	phosphatidylinositol-4-phospha...		Lus10039507 [exp]	30.0	0.7872

Compare expression of checked genes

Lus10000890 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.