Lus10000892 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62350 318 / 3e-111 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G46870 213 / 3e-69 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G09320 78 / 3e-16 VPS9B Vacuolar sorting protein 9 (VPS9) domain (.1)
AT1G13040 55 / 1e-08 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G27750 54 / 1e-08 EMB3123 EMBRYO DEFECTIVE 3123, unknown protein
AT3G42570 52 / 3e-08 peroxidase family protein (.1)
AT5G18475 52 / 8e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G31400 52 / 1e-07 GUN1 genomes uncoupled 1 (.1)
AT5G48730 49 / 1e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G74850 48 / 4e-06 PDE343, PTAC2 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036049 471 / 3e-171 AT1G62350 316 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040756 209 / 1e-67 AT3G46870 349 / 2e-122 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016476 206 / 2e-66 AT3G46870 346 / 3e-121 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011646 52 / 2e-07 AT1G13040 503 / 1e-175 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10011849 52 / 2e-07 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006373 49 / 1e-06 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036129 49 / 2e-06 AT1G13040 573 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10037592 49 / 2e-06 AT1G51965 792 / 0.0 ABA Overly-Sensitive 5 (.1)
Lus10017041 49 / 2e-06 AT2G36240 436 / 4e-151 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G275000 368 / 2e-130 AT1G62350 274 / 7e-94 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G038200 206 / 3e-66 AT3G46870 326 / 2e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G134300 101 / 9e-26 AT5G09320 114 / 1e-28 Vacuolar sorting protein 9 (VPS9) domain (.1)
Potri.009G169600 80 / 6e-18 AT5G09320 219 / 8e-67 Vacuolar sorting protein 9 (VPS9) domain (.1)
Potri.004G149400 54 / 2e-08 AT2G15980 477 / 4e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G243600 54 / 3e-08 AT5G48730 691 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G090400 53 / 7e-08 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G035700 49 / 1e-06 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.005G127500 49 / 1e-06 AT2G01390 635 / 0.0 EMBRYO DEFECTIVE 3111, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G276500 49 / 1e-06 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000892 pacid=23165397 polypeptide=Lus10000892 locus=Lus10000892.g ID=Lus10000892.BGIv1.0 annot-version=v1.0
ATGTCGCGTTTGATGTCGAATTTCGTTCTCCTACTCCGCAACTCCTCGTCGGCTCCGCGACTCCTGCTGGCTGAAAACTTCTCTAATTTGGCTTCCAGGA
CAAGGCCGAGCTTGTCGATATGGAGGCGGAAGAAAGAGATGGGGAAAGAAGGCCTTTTTGCTGCGAAGGAGCTGAAACGTCTCCAATCAAATCCCTCGCG
CCTCGACCGTTTCATCCATTCCCACGTCTCTCGCCTACTCAAGTCTGATCTCGTAGCTGTGCTAGCTGAGTTCCAGCGCCAAGATCAGGTCTTCCTCTGC
ATGAAGTTATATGACGTGATACGCAAAGAGATATGGTATAAGCCGGACATGTTCTTTTACAGGGACATGCTTATGATGCTTGCAAGGAACAGGAAAGTTG
ATGAAGCAGAAAAAGTTTGGCGAGATTTGAAGAGAGAGCAAGTTTTGTTCGATCAGCATACATTCGGAGACATCATGAGAGCCTTTCTGGACAATGGTTT
GCCAGCTGAAGCGATGCAGATATATGAGGAAATGAGACAGTCACCTGATCCACCACTGTCTCTGCCCTTCCGAGTGATCTTGAAAGGGCTAATTCCGTAT
CCGGAGTTAAGGGAGAAAGTGAAAGATGATTTCTTGGAGCTTTTTCCTAGCATGATTGTCTACGATCCAGCTGAGGATCTGTTTGACGATGAAGAATCTC
AAAGGGAAAGCGACTATGATTGA
AA sequence
>Lus10000892 pacid=23165397 polypeptide=Lus10000892 locus=Lus10000892.g ID=Lus10000892.BGIv1.0 annot-version=v1.0
MSRLMSNFVLLLRNSSSAPRLLLAENFSNLASRTRPSLSIWRRKKEMGKEGLFAAKELKRLQSNPSRLDRFIHSHVSRLLKSDLVAVLAEFQRQDQVFLC
MKLYDVIRKEIWYKPDMFFYRDMLMMLARNRKVDEAEKVWRDLKREQVLFDQHTFGDIMRAFLDNGLPAEAMQIYEEMRQSPDPPLSLPFRVILKGLIPY
PELREKVKDDFLELFPSMIVYDPAEDLFDDEESQRESDYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62350 Pentatricopeptide repeat (PPR)... Lus10000892 0 1
AT2G31450 ATNTH1 DNA glycosylase superfamily pr... Lus10000431 2.0 0.8034
AT4G01310 Ribosomal L5P family protein (... Lus10010251 4.0 0.8329
AT1G07380 Neutral/alkaline non-lysosomal... Lus10034565 6.3 0.8318
AT2G36410 Family of unknown function (DU... Lus10023876 8.1 0.8141
AT2G40760 Rhodanese/Cell cycle control p... Lus10029020 8.2 0.7588
AT1G04945 HIT-type Zinc finger family pr... Lus10008703 9.0 0.7861
Lus10033943 9.2 0.7909
AT1G17450 B-block binding subunit of TFI... Lus10015659 10.5 0.7839
AT1G67120 ATPases;nucleotide binding;ATP... Lus10037616 10.6 0.7883
AT5G48030 GFA2 gametophytic factor 2 (.1) Lus10011934 12.8 0.7989

Lus10000892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.