Lus10000914 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033201 147 / 4e-46 ND /
Lus10002071 59 / 9e-11 ND /
Lus10010826 59 / 1e-10 ND /
Lus10021528 57 / 3e-10 ND /
Lus10024215 57 / 4e-10 ND /
Lus10003781 57 / 4e-10 ND /
Lus10015042 57 / 5e-10 ND /
Lus10015582 56 / 5e-10 ND /
Lus10039674 56 / 6e-10 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000914 pacid=23182502 polypeptide=Lus10000914 locus=Lus10000914.g ID=Lus10000914.BGIv1.0 annot-version=v1.0
ATGAATCACTACCCTCTTATTGTGAAAGCTTTCTTCCTTACCCTTAGGAGGGACCTGCCCACTAGTGCCGACCTTACCTCTGTATTGTATGGTCATAGAG
TTTCATTAAGTCTAGAATCATTCTCCAGAATCATAGAGTTGACTACCAATGGTCTGAAACTTGCTGATGAGTCCCAACTCTCCTCCTTACTGGACTATAA
CACTAATGCCGAACTCGCTGCTCTAACCGGGGATCCTGACGCGCCTCTGACTATTGAATCACTTCCTAGGGACCTTCGAGTTCTTCACTGGCTTATCACC
CACTTCTTCCTTCCTAGGAGATCTCATCGATCGTCCATTACCTGGCTTGATGTTTACATAATGGCCAGTGCAGTAAAAAGTGTTGCGATTAGCCTCTCTG
ATCTTATGTGCATCCATATGATCAAATAA
AA sequence
>Lus10000914 pacid=23182502 polypeptide=Lus10000914 locus=Lus10000914.g ID=Lus10000914.BGIv1.0 annot-version=v1.0
MNHYPLIVKAFFLTLRRDLPTSADLTSVLYGHRVSLSLESFSRIIELTTNGLKLADESQLSSLLDYNTNAELAALTGDPDAPLTIESLPRDLRVLHWLIT
HFFLPRRSHRSSITWLDVYIMASAVKSVAISLSDLMCIHMIK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000914 0 1
AT2G39530 Uncharacterised protein family... Lus10031305 1.0 1.0000
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Lus10036966 2.4 0.9932
AT5G59700 Protein kinase superfamily pro... Lus10023324 2.8 0.9062
AT4G25350 SHB1 SHORT HYPOCOTYL UNDER BLUE1, E... Lus10037146 3.0 0.9851
Lus10020633 4.5 0.7624
AT4G22990 Major Facilitator Superfamily ... Lus10009314 5.0 0.8457
AT5G44150 unknown protein Lus10014193 6.5 0.6540
AT3G22040 Domain of unknown function (DU... Lus10007506 7.5 0.7167
AT3G43660 Vacuolar iron transporter (VIT... Lus10015135 7.7 0.7099
AT4G20780 CML42 calmodulin like 42 (.1) Lus10035611 8.5 0.7175

Lus10000914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.