Lus10000938 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28060 205 / 3e-69 Ribosomal protein S24e family protein (.1)
AT3G04920 185 / 2e-61 Ribosomal protein S24e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004123 254 / 1e-88 AT5G28060 219 / 5e-75 Ribosomal protein S24e family protein (.1)
Lus10015941 133 / 2e-41 AT5G28060 132 / 1e-41 Ribosomal protein S24e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G087800 207 / 3e-70 AT5G28060 223 / 9e-77 Ribosomal protein S24e family protein (.1)
Potri.008G152500 207 / 3e-70 AT5G28060 221 / 1e-75 Ribosomal protein S24e family protein (.1)
Potri.005G049400 207 / 4e-70 AT5G28060 222 / 3e-76 Ribosomal protein S24e family protein (.1)
Potri.013G036100 205 / 2e-69 AT5G28060 225 / 1e-77 Ribosomal protein S24e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01282 Ribosomal_S24e Ribosomal protein S24e
Representative CDS sequence
>Lus10000938 pacid=23172921 polypeptide=Lus10000938 locus=Lus10000938.g ID=Lus10000938.BGIv1.0 annot-version=v1.0
ATGGTGTCGGAGAAGCTCGGTTCTGGGATCACCATCCGCACCCGCAAGTTCATGACCAACCGTCTCCTCTCCAGGAAGCAGTTCGTCATTGAGGTTCTCC
ATCCAGGAAAGGCCAATGTTCCCAAGGCTGAAATCAAGGCTATGTTGGCGACGTTGTATTCTGTCAGGGATGAAAATGCTATCTTTGTGTTCAAGTTCAG
GACTCACTTTGGAGGTGGGAAGTCTACTGGCTTTGGGCTGATTTATGATTCTGTTGAGAATGCCAAGAAGTTCGAGCCTAAGTACAGACTAATCAGGAAT
GGACTTGATACCAAGGTTGAGAAGTCTAGGAAGCAGATGAAGGAACGTAAGAACAGGTCGAAGAAGATCCGTGGTGTAAAGAAGACCAAGGCTGGAGATG
CTGCCAAGGGTGGAAAGAAGAAGTGA
AA sequence
>Lus10000938 pacid=23172921 polypeptide=Lus10000938 locus=Lus10000938.g ID=Lus10000938.BGIv1.0 annot-version=v1.0
MVSEKLGSGITIRTRKFMTNRLLSRKQFVIEVLHPGKANVPKAEIKAMLATLYSVRDENAIFVFKFRTHFGGGKSTGFGLIYDSVENAKKFEPKYRLIRN
GLDTKVEKSRKQMKERKNRSKKIRGVKKTKAGDAAKGGKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28060 Ribosomal protein S24e family ... Lus10000938 0 1
AT1G26880 Ribosomal protein L34e superfa... Lus10030477 2.0 0.9629
AT3G16780 Ribosomal protein L19e family ... Lus10038417 2.6 0.9493
AT2G44120 Ribosomal protein L30/L7 famil... Lus10029423 3.2 0.9615
AT5G15200 Ribosomal protein S4 (.1.2) Lus10012839 5.0 0.9514
AT3G51800 ATEBP1, ATG2, E... A. THALIANA ERBB-3 BINDING PRO... Lus10003379 6.2 0.9410
AT1G48830 Ribosomal protein S7e family p... Lus10034909 6.9 0.9543
AT1G26880 Ribosomal protein L34e superfa... Lus10012829 7.1 0.9462
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 7.9 0.9583
AT1G07770 RPS15A ribosomal protein S15A (.1.2) Lus10032503 9.2 0.9379
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10004874 11.0 0.9496

Lus10000938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.