Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04940 107 / 2e-28 ATCYSD1 cysteine synthase D1 (.1) AT5G28020 103 / 6e-28 ATCYSD2 cysteine synthase D2 (.1.2.3.4.5.6) AT5G28030 100 / 5e-26 DES1 L-cysteine desulfhydrase 1 (.1.2) AT2G43750 87 / 1e-20 CPACS1, ATCS-B, OASB CHLOROPLAST O-ACETYLSERINE SULFHYDRYLASE 1, ARABIDOPSIS THALIANA CYSTEIN SYNTHASE-B, ARABIDOPSIS CYSTEINE SYNTHASE 1, O-acetylserine (thiol) lyase B (.1), O-acetylserine (thiol) lyase B (.2) AT3G61440 84 / 5e-20 ATCYSC1, ARATH;BSAS3;1 BETA-SUBSTITUTED ALA SYNTHASE 3;1, cysteine synthase C1 (.1.2.3) AT3G59760 83 / 4e-19 ATCS-C, OASC ARABIDOPSIS THALIANA CYSTEINSYNTHASE-C, O-acetylserine (thiol) lyase isoform C (.1), O-acetylserine (thiol) lyase isoform C (.2), O-acetylserine (thiol) lyase isoform C (.3) AT4G14880 82 / 6e-19 OLD3, CYTACS1, OASA1, ATCYS-3A ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) AT3G22460 76 / 9e-17 OASA2 O-acetylserine (thiol) lyase (OAS-TL) isoform A2 (.1) AT3G03630 61 / 2e-11 CS26 cysteine synthase 26 (.1) AT1G55880 55 / 2e-09 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004118 [exp] 137 / 5e-40 AT3G04940 375 / 3e-131 cysteine synthase D1 (.1) Lus10019002 [exp] 103 / 3e-27 AT4G14880 461 / 2e-164 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Lus10027056 [exp] 96 / 1e-23 AT3G59760 533 / 0.0 ARABIDOPSIS THALIANA CYSTEINSYNTHASE-C, O-acetylserine (thiol) lyase isoform C (.1), O-acetylserine (thiol) lyase isoform C (.2), O-acetylserine (thiol) lyase isoform C (.3) Lus10025589 [exp] 95 / 3e-23 AT3G59760 536 / 0.0 ARABIDOPSIS THALIANA CYSTEINSYNTHASE-C, O-acetylserine (thiol) lyase isoform C (.1), O-acetylserine (thiol) lyase isoform C (.2), O-acetylserine (thiol) lyase isoform C (.3) Lus10019003 [exp] 85 / 5e-20 AT4G14880 508 / 0.0 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Lus10015947 [exp] 85 / 5e-20 AT4G14880 509 / 0.0 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Lus10014765 [exp] 80 / 6e-18 AT3G61440 577 / 0.0 BETA-SUBSTITUTED ALA SYNTHASE 3;1, cysteine synthase C1 (.1.2.3) Lus10020342 [exp] 64 / 2e-12 AT3G03630 455 / 8e-160 cysteine synthase 26 (.1) Lus10043164 [exp] 62 / 1e-11 AT1G55880 625 / 0.0 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G048200 [exp] 104 / 2e-27 AT3G04940 429 / 6e-152 cysteine synthase D1 (.1) Potri.013G035200 [exp] 103 / 4e-27 AT4G14880 423 / 2e-149 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Potri.005G048400 [exp] 100 / 4e-26 AT4G14880 504 / 0.0 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Potri.005G048132 [exp] 99 / 2e-25 AT3G04940 402 / 5e-141 cysteine synthase D1 (.1) Potri.005G048066 [exp] 99 / 3e-25 AT3G04940 409 / 3e-144 cysteine synthase D1 (.1) Potri.013G035500 [exp] 97 / 1e-24 AT4G14880 509 / 0.0 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Potri.005G048700 [exp] 95 / 8e-24 AT4G14880 508 / 0.0 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Potri.013G127800 [exp] 94 / 3e-23 AT2G43750 516 / 0.0 CHLOROPLAST O-ACETYLSERINE SULFHYDRYLASE 1, ARABIDOPSIS THALIANA CYSTEIN SYNTHASE-B, ARABIDOPSIS CYSTEINE SYNTHASE 1, O-acetylserine (thiol) lyase B (.1), O-acetylserine (thiol) lyase B (.2) Potri.008G153300 [exp] 92 / 7e-23 AT4G14880 482 / 6e-173 ONSET OF LEAF DEATH 3, O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.1), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.2), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.3), O-acetylserine (thiol) lyase (OAS-TL) isoform A1 (.4) Potri.002G160800 [exp] 83 / 4e-19 AT3G61440 570 / 0.0 BETA-SUBSTITUTED ALA SYNTHASE 3;1, cysteine synthase C1 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00291 [flax] [poplar] PALP Pyridoxal-phosphate dependent enzyme
Representative CDS sequence Show only first row Show all	>Lus10000942 pacid=23172922 polypeptide=Lus10000942 locus=Lus10000942.g ID=Lus10000942.BGIv1.0 annot-version=v1.0 ATGCATGGACCAGAGTTATGGAGAGACTCAGGTGAACAAGTTGACCTTCTGATTGCTGATATGGGCACTGGAGGAACAATCACAGGTGCTGGCAGATTCC TTAAACAACAGAATCCAGACATCAAGGTTATCCGCATAGAACCAGCTGAAAGTGCTTTCTTCAATGGAGGCAAGCGTGGTAAAGAAGTAACAGATATGAT CTTGCTGTATGTGTATGGTGATATGATCTTGATTTATGGTTTCGTAGTATGCATCATATCGAAGGACTCTGTGCTGGAATTGCTCCTGATGTTCTTGATG TACAACTGCTTGACAAAGTCATCCGAGCAAGTGTCAAGTGAGGATGCAATTGAAACTGCCAAGTTGATTGCCATGAAGGAAGGTTTGCTGGTCATCTTTG CGAGTGCAGGCGAACGTTACTTGTCCACCAAGCTATTTGATTCAGTGCGCCACAAGACAGAGAACTTGACCATCCATTGA
AA sequence Show only first row Show all	>Lus10000942 pacid=23172922 polypeptide=Lus10000942 locus=Lus10000942.g ID=Lus10000942.BGIv1.0 annot-version=v1.0 MHGPELWRDSGEQVDLLIADMGTGGTITGAGRFLKQQNPDIKVIRIEPAESAFFNGGKRGKEVTDMILLYVYGDMILIYGFVVCIISKDSVLELLLMFLM YNCLTKSSEQVSSEDAIETAKLIAMKEGLLVIFASAGERYLSTKLFDSVRHKTENLTIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04940		ATCYSD1	cysteine synthase D1 (.1)		Lus10000942 [exp]	0	1

Compare expression of checked genes

Lus10000942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.