Lus10000961 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040145 297 / 5e-104 ND 40 / 4e-04
Lus10011019 135 / 5e-37 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
Lus10007598 117 / 5e-33 ND 42 / 2e-04
Lus10027768 103 / 6e-28 ND /
Lus10035527 102 / 2e-27 AT4G24640 40 / 4e-04 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10000822 45 / 1e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 40 / 0.0004 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012800 86 / 2e-21 ND /
Potri.005G022200 82 / 1e-19 ND /
Potri.013G012733 82 / 1e-19 ND /
Potri.005G195200 81 / 4e-19 AT5G64620 42 / 7e-05 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G022250 71 / 1e-15 ND /
Potri.013G012766 71 / 1e-15 ND /
Potri.005G022300 69 / 1e-14 ND /
Potri.005G022400 68 / 3e-14 ND /
Potri.001G073350 59 / 7e-11 ND /
Potri.002G191500 47 / 9e-07 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10000961 pacid=23148130 polypeptide=Lus10000961 locus=Lus10000961.g ID=Lus10000961.BGIv1.0 annot-version=v1.0
ATGGCTCCCAAGATCGTACATCTTCTTCCCTTGGCAGCCCTAATCTTAATCCTCTGCCTCCCATCCCAAACCGAATCACACTCGCCGTCGTCCACCTCCG
ACTTCCACAAATCCGTATGCCAGAAGAGCGACGACTACGCAGGGTGCATGAGGACCCTGAGATTGGACCCCAGGCTGGCCGCCACCGGCGACATTAATAC
CCTGGCGAAGGTAGCGATGGACAAGGCGCAGAGGAAGTCGATGACGTTGAGCGACAAGTTTGCGAAGATGGAGAACGAGAACCCCGATCCGAAGGTGAAG
GAAGCGCTGAAGATGTGCGCTTTCGATTTCAAGGACGCGAAGATCTTCTTCAACCCTAGGTTGCTTGGGGATCCGACAGGGAGCATGGATATTCATTCGG
CGTTGGACAATTGGCAGAACTGCGAGACTTTAATGGAGCAGAATCCGGATCTGCAGAAGATGGCTCCTGCGCTGAGGAAGTGGAAGCACCTGTATGCGAT
TGCGAATGGGGCGGTTGTTTACGCCGAAGATGAATCTGGCGGTGGTGGCGGTGGGGATTACCCTTAA
AA sequence
>Lus10000961 pacid=23148130 polypeptide=Lus10000961 locus=Lus10000961.g ID=Lus10000961.BGIv1.0 annot-version=v1.0
MAPKIVHLLPLAALILILCLPSQTESHSPSSTSDFHKSVCQKSDDYAGCMRTLRLDPRLAATGDINTLAKVAMDKAQRKSMTLSDKFAKMENENPDPKVK
EALKMCAFDFKDAKIFFNPRLLGDPTGSMDIHSALDNWQNCETLMEQNPDLQKMAPALRKWKHLYAIANGAVVYAEDESGGGGGGDYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000961 0 1
AT1G78190 Trm112p-like protein (.1) Lus10017505 1.7 0.7842
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10015718 5.5 0.7834
AT4G37090 unknown protein Lus10019656 7.7 0.7751
AT3G16500 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible... Lus10038284 10.4 0.7463
AT2G34510 Protein of unknown function, D... Lus10023314 11.6 0.7801
AT5G59100 Subtilisin-like serine endopep... Lus10042555 11.8 0.7737
AT3G16500 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible... Lus10038285 12.5 0.7204
AT4G23630 RTNLB1, BTI1 Reticulan like protein B1, VIR... Lus10032313 18.5 0.7745
AT2G34510 Protein of unknown function, D... Lus10038495 20.2 0.7684
AT2G36730 Pentatricopeptide repeat (PPR)... Lus10004373 22.8 0.7656

Lus10000961 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.