Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29430 235 / 2e-81 RPS15AE ribosomal protein S15A E (.1) AT2G19720 231 / 3e-80 RPS15AB ribosomal protein S15A B (.1) AT2G39590 136 / 2e-42 Ribosomal protein S8 family protein (.1) AT5G59850 134 / 1e-41 Ribosomal protein S8 family protein (.1) AT1G07770 134 / 1e-41 RPS15A ribosomal protein S15A (.1.2) AT3G46040 132 / 1e-40 RPS15AD ribosomal protein S15A D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040543 [exp] 261 / 9e-92 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1) Lus10040309 [exp] 134 / 2e-41 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10043001 [exp] 134 / 2e-41 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10029461 [exp] 134 / 2e-41 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 134 / 2e-41 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10005960 [exp] 134 / 2e-41 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10023429 [exp] 134 / 2e-41 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G071250 [exp] 231 / 4e-80 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.009G071400 [exp] 231 / 4e-80 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.010G208700 [exp] 138 / 3e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 138 / 3e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.003G114800 [exp] 138 / 3e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 137 / 1e-42 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [flax] [poplar] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Lus10000975 pacid=23163393 polypeptide=Lus10000975 locus=Lus10000975.g ID=Lus10000975.BGIv1.0 annot-version=v1.0 ATGGGAAGGAGGATACTGAACGATGCATTGAGGGCCATAGTCAATGCGGAAAAGAGAGCCAAAGTTTCTGTGGAGCTTCAACCTATTTCCACGGTCATGT CGTCTTTCCTTAGGATCATGAAAGATCGAGGGTACATAAAAAATTATCAAGTGTTTGACCCGCAGCGAGTGGGGAGGATAACGGTTGAACTACAAGGAAG GGTAAAAGATTGCAAGGCACTTACTTACAGGCAAGATCTCAAGGCTAAGGAAATTGAAACTTACACAAAGCAAACTCTTCCAACACGTCAGTGGGGTTAT GTAGTGATCTCAACTCCGGACGGTGTACTGGATCACGAGGAGGCAATTAAACGAAACGTAGGGGGTCAGGTTCTTGGTTACTTTCATTAG
AA sequence Show only first row Show all	>Lus10000975 pacid=23163393 polypeptide=Lus10000975 locus=Lus10000975.g ID=Lus10000975.BGIv1.0 annot-version=v1.0 MGRRILNDALRAIVNAEKRAKVSVELQPISTVMSSFLRIMKDRGYIKNYQVFDPQRVGRITVELQGRVKDCKALTYRQDLKAKEIETYTKQTLPTRQWGY VVISTPDGVLDHEEAIKRNVGGQVLGYFH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	0	1
AT5G50810		TIM8	translocase inner membrane sub...		Lus10022450 [exp]	1.4	0.9355
AT5G51960			unknown protein		Lus10041422 [exp]	3.5	0.9201
AT5G11390		WIT1	WPP domain-interacting protein...		Lus10005102 [exp]	4.0	0.9130
AT5G40080			Mitochondrial ribosomal protei...		Lus10003002 [exp]	4.2	0.9230
AT3G52390			TatD related DNase (.1.2)		Lus10013590 [exp]	4.9	0.9073
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	6.5	0.9333
AT5G41685			Mitochondrial outer membrane t...		Lus10040758 [exp]	7.3	0.8854
AT3G02080			Ribosomal protein S19e family ...		Lus10032992 [exp]	7.9	0.9240
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	9.4	0.9211
AT4G14320			Zinc-binding ribosomal protein...		Lus10038130 [exp]	9.6	0.9306

Compare expression of checked genes

Lus10000975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.