Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19810 74 / 2e-16 ChiC class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19800 67 / 3e-14 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19770 59 / 2e-11 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19720 58 / 5e-11 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19730 54 / 2e-09 Glycosyl hydrolase superfamily protein (.1) AT4G19820 54 / 2e-09 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19740 49 / 8e-08 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019061 [exp] 204 / 5e-63 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10040021 [exp] 99 / 3e-25 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10003408 [exp] 76 / 1e-18 AT4G19770 98 / 5e-26 Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10017124 [exp] 55 / 9e-10 AT4G19810 260 / 9e-84 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10018329 [exp] 54 / 2e-09 AT4G19810 268 / 1e-86 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10041639 [exp] 48 / 2e-07 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1) Lus10024081 [exp] 47 / 8e-07 AT1G61500 333 / 5e-102 S-locus lectin protein kinase family protein (.1) Lus10032626 [exp] 0 / 1 AT4G19810 105 / 3e-27 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111900 [exp] 107 / 4e-28 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.018G111800 [exp] 87 / 4e-21 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111700 [exp] 84 / 4e-20 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.006G188400 [exp] 62 / 2e-12 AT4G19810 477 / 2e-169 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G262001 [exp] 57 / 1e-10 AT4G19810 283 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G261800 [exp] 57 / 1e-10 AT4G19810 286 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112000 [exp] 54 / 2e-09 AT4G19810 284 / 3e-93 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112100 [exp] 52 / 5e-09 AT4G19810 279 / 3e-91 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00704 [flax] [poplar] Glyco_hydro_18 Glycosyl hydrolases family 18
Representative CDS sequence Show only first row Show all	>Lus10000981 pacid=23163396 polypeptide=Lus10000981 locus=Lus10000981.g ID=Lus10000981.BGIv1.0 annot-version=v1.0 ATGACCTCCATTATTTCCTGTCAGAGCACCTTCATCCGATCATCAATCCAAACCACCAGACTCTACGGCTTCCAAAGAATCGATTTGTTGACCCACGGTA CGGACGTTGGGAAGATAGAAACCCTATTTGAGGAATTCAGATCTGCGATCGATTCAGAAGCCCAAAAATCGAACAATTCGAAGCTCTTACTTACCATGGC GGTTCCAAGATCTTCGAACCTGAATTCCGCCGGGTATCTAGTTCGATCAATGGCGACGAATCTGGTTTGGGCTAACCCGTTGGCCCACGATTACCACTTG CCGGCGAAGGAGAACTTCACGGTGAACCACGACGCGTTATTCGGTGATGATGATGGCGGCTAG
AA sequence Show only first row Show all	>Lus10000981 pacid=23163396 polypeptide=Lus10000981 locus=Lus10000981.g ID=Lus10000981.BGIv1.0 annot-version=v1.0 MTSIISCQSTFIRSSIQTTRLYGFQRIDLLTHGTDVGKIETLFEEFRSAIDSEAQKSNNSKLLLTMAVPRSSNLNSAGYLVRSMATNLVWANPLAHDYHL PAKENFTVNHDALFGDDDGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Lus10000981 [exp]	0	1
AT2G26390			Serine protease inhibitor (SER...		Lus10039336 [exp]	4.1	0.9268
AT3G14880			unknown protein		Lus10013746 [exp]	4.7	0.8153
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	6.2	0.9122
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	7.5	0.9122
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	8.7	0.9122
AT4G17260			Lactate/malate dehydrogenase f...		Lus10006030 [exp]	9.3	0.7149
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	9.7	0.9104
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	10.7	0.9103
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	11.5	0.9095
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	12.3	0.9081

Compare expression of checked genes

Lus10000981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.