Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31100 85 / 3e-20 alpha/beta-Hydrolases superfamily protein (.1) AT1G06250 79 / 4e-18 alpha/beta-Hydrolases superfamily protein (.1) AT2G42690 66 / 2e-13 alpha/beta-Hydrolases superfamily protein (.1) AT1G30370 45 / 4e-06 DLAH DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013935 [exp] 213 / 1e-69 AT4G18550 337 / 2e-113 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10013936 [exp] 138 / 1e-40 AT4G18550 345 / 2e-116 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10000985 [exp] 84 / 3e-20 AT4G18550 375 / 1e-129 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10013932 [exp] 84 / 5e-20 AT4G18550 427 / 5e-149 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10017668 [exp] 71 / 2e-15 AT4G18550 420 / 1e-145 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10017975 [exp] 65 / 3e-13 AT2G42690 524 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Lus10041967 [exp] 64 / 9e-13 AT2G42690 490 / 3e-173 alpha/beta-Hydrolases superfamily protein (.1) Lus10015521 [exp] 49 / 2e-07 AT1G30370 524 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10038526 [exp] 47 / 6e-07 AT1G30370 539 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G026500 [exp] 91 / 1e-22 AT4G18550 326 / 5e-109 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.015G026400 [exp] 91 / 2e-22 AT4G18550 330 / 5e-110 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.011G064400 [exp] 87 / 3e-21 AT4G18550 501 / 3e-177 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.004G054800 [exp] 82 / 2e-19 AT4G18550 516 / 0.0 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.004G054600 [exp] 81 / 7e-19 AT4G18550 384 / 1e-131 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.003G101800 [exp] 60 / 1e-11 AT2G42690 531 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000983 pacid=23162254 polypeptide=Lus10000983 locus=Lus10000983.g ID=Lus10000983.BGIv1.0 annot-version=v1.0 ATGAGGATAAGGAACTTTCAAGATGTGGTTGTGTCAAACTTTCCGTCGAAGATTTTTGGATTTTTTGAGGTTGGGAACGAGTTGTTGATCCATTCGTTCT CGTCCTACCTAAAGCCGTTGGTGAACCCTCATAGCTTGGAGGTGTACATGCATGGCTTAGCCGGGGTGGATGGCTTCGGGAAGTTCAAGCTGGTGGTTCA TAGGGATGTTTCGTTACTCAACAAGTGGCTCGATGCGCTTAAGGACGAATATAAGGTTCCAAAAGAGTGGTGGATCGCGAAGAACTGGTCCATGGTCGAC AGTGGTGTGTGGATGTTGCAGGAGGTTATGCCGCCACCTCCGGTGGCTCTTGTTTGA
AA sequence Show only first row Show all	>Lus10000983 pacid=23162254 polypeptide=Lus10000983 locus=Lus10000983.g ID=Lus10000983.BGIv1.0 annot-version=v1.0 MRIRNFQDVVVSNFPSKIFGFFEVGNELLIHSFSSYLKPLVNPHSLEVYMHGLAGVDGFGKFKLVVHRDVSLLNKWLDALKDEYKVPKEWWIAKNWSMVD SGVWMLQEVMPPPPVALV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31100			alpha/beta-Hydrolases superfam...		Lus10000983 [exp]	0	1
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10024973 [exp]	3.3	0.7955
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10040106 [exp]	7.1	0.7533
AT1G71460			Pentatricopeptide repeat (PPR-...		Lus10006174 [exp]	9.0	0.7033
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Lus10043483 [exp]	12.6	0.7384
AT3G42150			unknown protein		Lus10031451 [exp]	13.6	0.7237
AT1G07360	C3HZnF	MAC5A	MOS4-associated complex subuni...		Lus10012448 [exp]	14.1	0.7033
AT5G37590			Tetratricopeptide repeat (TPR)...		Lus10004034 [exp]	17.1	0.7436
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	19.1	0.7379
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023453 [exp]	21.0	0.7205
AT1G24340		EMB260, EMB2421	EMBRYO DEFECTIVE 260, EMBRYO D...		Lus10006431 [exp]	21.8	0.6066

Compare expression of checked genes

Lus10000983 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.