Lus10001030 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001031 114 / 2e-33 ND 38 / 8e-04
Lus10003442 112 / 1e-32 ND 37 / 0.002
Lus10003443 102 / 8e-29 ND /
Lus10019332 93 / 5e-25 ND /
Lus10006964 67 / 1e-13 AT5G48540 38 / 0.008 receptor-like protein kinase-related family protein (.1)
Lus10025477 66 / 1e-13 ND /
Lus10025476 62 / 4e-12 AT2G31620 44 / 3e-05 Receptor-like protein kinase-related family protein (.1)
Lus10009371 55 / 2e-10 ND /
Lus10012130 54 / 6e-10 ND 39 / 4e-04
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10001030 pacid=23171561 polypeptide=Lus10001030 locus=Lus10001030.g ID=Lus10001030.BGIv1.0 annot-version=v1.0
ATGATGTTACGATCGTTAGCAGCAGTGATGTTCCTGGTAACAATCAAGTGGCCGTCTCGGGTAAGCTCGATCCATGATCCACACTGTGTATTAAGGGACA
ACCAAATTCAGTGCGCAAAAGCTCTGTTGCCGATCGATTCGCGGGCGTGTCAATATAACATATTGAGTGATTTTGAGGACGATGTCTTTAGCACCAATGA
TCCTATTGGTTGTCACAATGTTCCTTTCTCGGATGCCGAGGGTGGTTCCTTCGTAGCATTCGCTTATTTCTCGTGTAACGAGTTAAGTTACAAGTGCAAG
CTCTGTTTTGACGACGCCTCCCAACAACTGTGGGATTCTTGTCCCGGTAGAGCTGGAGGGACCATCTCGCTTGAGCACTGTTGTCTGAGGTATGAGACTT
ATTATAGCTTCTGTCGTTCCTACTGA
AA sequence
>Lus10001030 pacid=23171561 polypeptide=Lus10001030 locus=Lus10001030.g ID=Lus10001030.BGIv1.0 annot-version=v1.0
MMLRSLAAVMFLVTIKWPSRVSSIHDPHCVLRDNQIQCAKALLPIDSRACQYNILSDFEDDVFSTNDPIGCHNVPFSDAEGGSFVAFAYFSCNELSYKCK
LCFDDASQQLWDSCPGRAGGTISLEHCCLRYETYYSFCRSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001030 0 1
AT1G13570 F-box/RNI-like superfamily pro... Lus10041818 8.0 0.7665
AT1G61290 ATSYP124, SYP12... syntaxin of plants 124 (.1) Lus10011244 9.9 0.7994
AT2G25770 Polyketide cyclase/dehydrase a... Lus10040227 11.2 0.7622
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10040245 14.9 0.7856
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10026130 16.9 0.7718
AT2G25770 Polyketide cyclase/dehydrase a... Lus10028262 18.3 0.7645
AT4G05400 copper ion binding (.1.2) Lus10031070 20.6 0.7290
AT1G75030 ATLP-3 thaumatin-like protein 3 (.1) Lus10015705 21.4 0.7310
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023318 21.7 0.7516
Lus10037930 23.2 0.7426

Lus10001030 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.