Lus10001031 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003442 218 / 2e-74 ND 37 / 0.002
Lus10003443 157 / 1e-50 ND /
Lus10001030 114 / 1e-33 ND /
Lus10019332 103 / 3e-29 ND /
Lus10012129 56 / 8e-11 ND /
Lus10012132 54 / 6e-10 ND 38 / 0.001
Lus10006964 54 / 2e-09 AT5G48540 38 / 0.008 receptor-like protein kinase-related family protein (.1)
Lus10025475 52 / 1e-08 ND /
Lus10010417 50 / 1e-08 ND 37 / 0.002
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10001031 pacid=23171564 polypeptide=Lus10001031 locus=Lus10001031.g ID=Lus10001031.BGIv1.0 annot-version=v1.0
ATGATGTTACAATCACTAACAGTAGTGTTCTTCCTGGTAGCAATCATCACGTGTTCTAGCGTGAACTCCATTGATGATCCATACTGTGATGGATTGTCCG
ACGGCGAATCTAGGTGCAATTCGGACCTGTTCCCGCCGAGTGCTGAGAGCATTCAAGAGTACCTATTGGACAGGTTAAAGGAGGAAGTTTTCCAATGCAA
AATACCCATCGCTTGCTACAATATTGATTCAACCAACGGCTATTTCTCTTGCAATCAGTTACGTGACGACTGCAAAACATGTTACGATGCCGCCGTGGTC
AATATGAAAAATTGGTGTCCTGGTAGAGCTGGTGCAGCTACCTCGTTGGAGCATTGTTGTCTAAGGTATGAGACTGCATATCACTTTTGTCGTCCCATGT
GA
AA sequence
>Lus10001031 pacid=23171564 polypeptide=Lus10001031 locus=Lus10001031.g ID=Lus10001031.BGIv1.0 annot-version=v1.0
MMLQSLTVVFFLVAIITCSSVNSIDDPYCDGLSDGESRCNSDLFPPSAESIQEYLLDRLKEEVFQCKIPIACYNIDSTNGYFSCNQLRDDCKTCYDAAVV
NMKNWCPGRAGAATSLEHCCLRYETAYHFCRPM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001031 0 1
AT5G04885 Glycosyl hydrolase family prot... Lus10013388 5.3 0.9296
AT1G78960 ATLUP2 lupeol synthase 2 (.1) Lus10033355 8.4 0.9075
AT3G01140 MYB NOK, ATMYB106 NOECK, myb domain protein 106 ... Lus10019086 13.3 0.9410
Lus10019052 18.5 0.9345
AT1G65330 MADS AGL37, PHE1 PHERES1, AGAMOUS-like 37, MADS... Lus10004150 18.6 0.9335
AT4G22756 ATSMO1-2, ATSMO... sterol C4-methyl oxidase 1-2 (... Lus10004324 32.0 0.9215
AT1G17260 AHA10 autoinhibited H\(+\)-ATPase is... Lus10037466 32.9 0.9128
AT5G02540 NAD(P)-binding Rossmann-fold s... Lus10025321 36.0 0.8834
AT3G57440 unknown protein Lus10031072 39.4 0.8843
AT3G29810 COBL2 COBRA-like protein 2 precursor... Lus10026288 39.4 0.9114

Lus10001031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.