Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 167 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72890 156 / 5e-45 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G66090 152 / 9e-44 Disease resistance protein (TIR-NBS class) (.1) AT1G72920 148 / 1e-43 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G41750 155 / 7e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72940 148 / 2e-42 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G46450 152 / 6e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63880 152 / 7e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G31540 150 / 2e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G46490 144 / 3e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008027 [exp] 478 / 3e-173 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018309 [exp] 375 / 1e-130 AT1G27180 245 / 1e-71 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10037406 [exp] 380 / 3e-124 AT5G36930 395 / 5e-116 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10017143 [exp] 372 / 5e-122 AT1G27180 387 / 6e-116 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029628 [exp] 378 / 6e-122 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10035674 [exp] 370 / 4e-119 AT5G36930 410 / 1e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042714 [exp] 348 / 2e-112 AT5G36930 411 / 3e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10010574 [exp] 348 / 3e-112 AT5G36930 397 / 4e-119 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020238 [exp] 336 / 1e-107 AT1G69550 391 / 7e-117 disease resistance protein (TIR-NBS-LRR class) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G019710 [exp] 193 / 1e-58 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143100 [exp] 186 / 3e-58 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G046000 [exp] 192 / 3e-57 AT5G36930 496 / 1e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 190 / 3e-57 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 194 / 1e-56 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 192 / 4e-56 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 192 / 7e-56 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 192 / 7e-56 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 186 / 1e-55 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 190 / 2e-55 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10001040 pacid=23171549 polypeptide=Lus10001040 locus=Lus10001040.g ID=Lus10001040.BGIv1.0 annot-version=v1.0 ATGGAGCTGGAGCTGATGCCTTCAGGCGAAGGAACAGCAGTTCAAACGTCATGGGCAGAACGGAAACCTGCCGAGTATGAGGTCTTTTTGAGCTTTAGAG GCCCTGACGTTCGCAAAAGCTTTGCCGACTGTCTATACAGCTATTTGGTCCGTTCCAAAATCCGCACATTCAGGGACGAGGAAGAGCTTCGCAAGGGGGA GAGCATTGGGCCTTCCTTGGTTCAGGCTATCACCGAGTCAAAGATTTACATCCCGATTTTCACAAAGAGCTATGCTGCTAGCAAATGGTGCCTTCAAGAA CTAGCCGAGATGGTTCAGTGTTGGAAACAAGGGAAAGGACACATCATATTGCCCATTTTCTATTTCATGGACCCCAGAGATGTGCGGCATCAAGCTGGTC TTTACGAGGTGGCATTTGAACAACACAGTAAGAAGCATGACCCCATAACAGTACAAGAATGGAGGACAGCTCTCCAAGAAGTTGGGCAAATGAAAGGATG GCACGTTACTGAATCAGATGGACAGGGAGCTGTGATAGATGAGGTTTTTTCTAAGGTGGAGTTGCATCTGAGGAGTAACTATACTTTAGTCACTGAAGAG CTGGTGGGAATCGATTGTCACATGCAAGAAGTGACGAGATTGTTGAATCTAGACTCCGCAGATTTGAAGGTGGTCGGGATTCATGGAATTGGCGGTATAA GGAAATTGGGGGTATGGGGAAAACTACCATAG
AA sequence Show only first row Show all	>Lus10001040 pacid=23171549 polypeptide=Lus10001040 locus=Lus10001040.g ID=Lus10001040.BGIv1.0 annot-version=v1.0 MELELMPSGEGTAVQTSWAERKPAEYEVFLSFRGPDVRKSFADCLYSYLVRSKIRTFRDEEELRKGESIGPSLVQAITESKIYIPIFTKSYAASKWCLQE LAEMVQCWKQGKGHIILPIFYFMDPRDVRHQAGLYEVAFEQHSKKHDPITVQEWRTALQEVGQMKGWHVTESDGQGAVIDEVFSKVELHLRSNYTLVTEE LVGIDCHMQEVTRLLNLDSADLKVVGIHGIGGIRKLGVWGKLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10001040 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10001039 [exp]	1.0	0.9423
AT5G36930			Disease resistance protein (TI...		Lus10008026 [exp]	1.4	0.9123
AT5G47020			unknown protein		Lus10007259 [exp]	8.8	0.7767
AT5G05970		NEDD1	NEURAL PRECURSOR CELL EXPRESSE...		Lus10001024 [exp]	14.7	0.7735
AT1G12930			ARM repeat superfamily protein...		Lus10041503 [exp]	16.1	0.7848
AT5G62600		MOS14	modifier of snc1-1, 14, ARM re...		Lus10042159 [exp]	21.4	0.7893
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10043456 [exp]	24.6	0.7961
AT2G36850		CHOR, ATGSL8, A...	CHORUS, glucan synthase-like 8...		Lus10040891 [exp]	30.2	0.7852
AT3G52640			Zn-dependent exopeptidases sup...		Lus10007388 [exp]	34.8	0.7838
AT1G32750		GTD1, TAF1, HAF...	TBP-ASSOCIATED FACTOR 1, HISTO...		Lus10027579 [exp]	37.6	0.7843

Compare expression of checked genes

Lus10001040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.