Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53160 306 / 2e-107 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT1G01360 290 / 3e-101 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT4G01026 278 / 3e-96 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT4G27920 273 / 1e-94 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT5G05440 176 / 6e-56 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G38310 173 / 6e-55 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 171 / 1e-53 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT2G26040 166 / 4e-52 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT4G17870 157 / 6e-49 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G73000 149 / 2e-45 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039335 [exp] 390 / 2e-140 AT5G53160 295 / 4e-103 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10038818 [exp] 320 / 1e-112 AT5G53160 287 / 1e-99 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10014929 [exp] 315 / 8e-111 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10040916 [exp] 266 / 6e-92 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Lus10014239 [exp] 187 / 4e-60 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 186 / 6e-59 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 175 / 2e-55 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 161 / 5e-51 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10024991 [exp] 154 / 2e-47 AT2G26040 264 / 7e-91 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G000800 [exp] 326 / 2e-115 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.015G020500 [exp] 326 / 2e-115 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 321 / 2e-113 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.001G092500 [exp] 319 / 8e-113 AT5G53160 296 / 7e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.002G169400 [exp] 312 / 5e-110 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.014G097100 [exp] 311 / 1e-109 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.016G125400 [exp] 188 / 1e-60 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 186 / 7e-60 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.018G054400 [exp] 174 / 1e-55 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.010G183900 [exp] 171 / 6e-54 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10001059 pacid=23141285 polypeptide=Lus10001059 locus=Lus10001059.g ID=Lus10001059.BGIv1.0 annot-version=v1.0 ATGAATTTCGATACTAGCAATGGAGCGGCGACCACGACTGCCAAGGGGCTAGGGAGCGTGGAGACCGAGTCCATCAGGAGACACCATAGGCATGATCCTG GCGAGAATCAGTGCAGCTCCGTTCTCATTAAGCACATCAAAGCTCCGGTTCATCTGGTTTGGTCCCTGGTTAGGAGATTCGATCAACCGCAGAAGTACAA GCCATTCATCAGCAGATGCGTTGCTCGTGGGAATCTCGAGATTGGGAGTCTTAGAGAGATTGATGTTAAATCAGGACTTCCAGCTACCACAAGTACTGAA AGATTAGAGCTTCTTGATGATGAGGAGCATATCCTCAGCATGCGCATTGTTGGCGGAGATCACAGACTAAAGAACTATTCTTCAATAGTTTCCCTACACC CGGAGATTCTCGATGGAAGACCAGGGACATTAGTGATCGAATCATTTGTGGTGGATGTACCAGATGGGAACACCAAGGACGAGACCTGCTACTTTGTTGA AGCTCTCATCAAATGCAACCTCAAGTCTCTGGCTGATGTATCTGAGCGGCTTGCGGTACAGGACAGGACCGAACCCATCGATCGTAACTGA
AA sequence Show only first row Show all	>Lus10001059 pacid=23141285 polypeptide=Lus10001059 locus=Lus10001059.g ID=Lus10001059.BGIv1.0 annot-version=v1.0 MNFDTSNGAATTTAKGLGSVETESIRRHHRHDPGENQCSSVLIKHIKAPVHLVWSLVRRFDQPQKYKPFISRCVARGNLEIGSLREIDVKSGLPATTSTE RLELLDDEEHILSMRIVGGDHRLKNYSSIVSLHPEILDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPIDRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10001059 [exp]	0	1
AT2G28550	AP2_ERF	TOE1, RAP2.7	TARGET OF EARLY ACTIVATION TAG...		Lus10040365 [exp]	1.4	0.9387
AT3G25910			Protein of unknown function (D...		Lus10043292 [exp]	2.0	0.9347
AT1G29280	WRKY	ATWRKY65, WRKY6...	WRKY DNA-binding protein 65 (....		Lus10015229 [exp]	3.2	0.9115
AT3G01980			NAD(P)-binding Rossmann-fold s...		Lus10041545 [exp]	6.5	0.9103
					Lus10025502 [exp]	19.2	0.9044
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036817 [exp]	19.2	0.9158
AT1G32310			unknown protein		Lus10030955 [exp]	20.4	0.8989
AT1G24440			RING/U-box superfamily protein...		Lus10036937 [exp]	20.9	0.9158
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10024941 [exp]	24.4	0.9052
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Lus10018888 [exp]	26.1	0.8938

Compare expression of checked genes

Lus10001059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.