Plant FIBer expression Database

Lus10001072 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G25260 122 / 4e-36 Ribosomal protein L10 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030073
[exp]
169 / 1e-54 AT1G25260 343 / 5e-121 Ribosomal protein L10 family protein (.1)
Lus10043280
[exp]
166 / 2e-53 AT1G25260 351 / 3e-124 Ribosomal protein L10 family protein (.1)
Lus10019424
[exp]
161 / 1e-47 AT2G26830 471 / 1e-161 embryo defective 1187, Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G156300
[exp]
147 / 4e-46 AT1G25260 353 / 5e-125 Ribosomal protein L10 family protein (.1)
Potri.001G460100
[exp]
140 / 2e-43 AT1G25260 352 / 1e-124 Ribosomal protein L10 family protein (.1)
PFAM info
Representative CDS sequence
>Lus10001072 pacid=23149476 polypeptide=Lus10001072 locus=Lus10001072.g ID=Lus10001072.BGIv1.0 annot-version=v1.0
ATGGTTGAGATAGGAGTCAAGGGACCTCTTGACCAATTTACTCACGAAATGGAGACATTTCTTCTTAAACAAGGGTTTCCTGTTCGGCTGAACGAAGGTC
CCGTGGAACGTATTTCAGACTTTGTTCTCTGTGAAGAAGGAAAGCCTTTGTCTCCTGAATCAGCTCGAATACTGAGGCTGTTAGGCATTAAGATGACTAC
CTTCCGGCTTAATTTAATCTGCAGATGGGGGTCAGAGGATTTTGAGCTGTATAAAGAGGGACTTGATGAAGCTTCTGATATAGAATCTGCATGA
AA sequence
>Lus10001072 pacid=23149476 polypeptide=Lus10001072 locus=Lus10001072.g ID=Lus10001072.BGIv1.0 annot-version=v1.0
MVEIGVKGPLDQFTHEMETFLLKQGFPVRLNEGPVERISDFVLCEEGKPLSPESARILRLLGIKMTTFRLNLICRWGSEDFELYKEGLDEASDIESA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G25260 Ribosomal protein L10 family p... Lus10001072
[exp]
0 1
AT1G26660 Prefoldin chaperone subunit fa... Lus10026631
[exp]
1.4 0.9080
AT5G57910 unknown protein Lus10036255
[exp]
1.4 0.8906
AT5G46030 unknown protein Lus10025438
[exp]
2.4 0.8804
AT5G08490 SLG1 SLOW GROWTH 1, Tetratricopepti... Lus10014828
[exp]
3.9 0.8623
AT5G64560 MRS2-2, ATMGT9 magnesium transporter 9 (.1.2) Lus10041169
[exp]
4.2 0.8511
AT1G67120 ATPases;nucleotide binding;ATP... Lus10037615
[exp]
4.9 0.8690
AT2G45910 U-box domain-containing protei... Lus10036363
[exp]
6.0 0.8550
AT4G27280 Calcium-binding EF-hand family... Lus10039724
[exp]
6.3 0.8523
AT3G24560 RSY3 RASPBERRY 3, Adenine nucleotid... Lus10035028
[exp]
6.5 0.8545
AT1G60560 SWIM zinc finger family protei... Lus10035898
[exp]
7.2 0.8359

Lus10001072 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.