Lus10001078 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G148200 49 / 2e-07 AT5G44170 46 / 7e-06 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10001078 pacid=23148923 polypeptide=Lus10001078 locus=Lus10001078.g ID=Lus10001078.BGIv1.0 annot-version=v1.0
ATGGGTCGGTTTCAGTCGGTGAACGTCCGCAAAGATGATCGACAACTTACAATCCACGAAGCCGGCGACGTCTACGACCCTCAAACGCGGTGCACCCTCT
CCGGCGCGTGGCTATGGGACTCCTCTCTTTTCCTCTCCCGCTTCCTCTCTTCTACTTCTTCCCTAATCGACTTTCGTGGCAAATTCGTGCTGGAGCTTGG
CGCGGGAAGTACGGGCATCCCCTGGATGACGTCAGCTCTACAGCCAATCAATGAAACGACGATTGAGGTAGGCGTGTTTGCCGTTTATAGTATAGAGATC
ATACAGCCACTCAATGAAACGACGATTGATAGATATTGGGCCGCTGATGGCCTGCAGTGGGTAATAAGCTGCTTATCCAGCAAGATGTTCTTTAGTGCTT
GTTTTTTAAATTATTGCATTGTTAGTGCTGAAGTGTCAAATTAA
AA sequence
>Lus10001078 pacid=23148923 polypeptide=Lus10001078 locus=Lus10001078.g ID=Lus10001078.BGIv1.0 annot-version=v1.0
MGRFQSVNVRKDDRQLTIHEAGDVYDPQTRCTLSGAWLWDSSLFLSRFLSSTSSLIDFRGKFVLELGAGSTGIPWMTSALQPINETTIEVGVFAVYSIEI
IQPLNETTIDRYWAADGLQWVISCLSSKMFFSACFLNYCIVSAEVSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001078 0 1
Lus10003825 3.9 0.9709
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10014062 5.5 0.9709
Lus10029261 6.7 0.9709
AT5G56990 unknown protein Lus10029528 7.7 0.9709
AT3G19920 unknown protein Lus10010181 8.5 0.8148
Lus10038051 8.7 0.9709
AT5G01660 unknown protein Lus10040599 9.5 0.9709
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10029635 10.2 0.9709
AT4G18770 MYB ATMYB98 myb domain protein 98 (.1) Lus10002384 10.6 0.7550
AT5G15110 Pectate lyase family protein (... Lus10030791 11.3 0.9686

Lus10001078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.