Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48440 160 / 7e-52 B-cell receptor-associated 31-like (.1) AT3G17780 157 / 1e-50 unknown protein AT5G17190 89 / 9e-24 unknown protein AT3G03160 89 / 2e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040126 [exp] 212 / 3e-72 AT1G48440 191 / 3e-64 B-cell receptor-associated 31-like (.1) Lus10034347 [exp] 85 / 3e-22 AT5G17190 246 / 5e-86 unknown protein Lus10005110 [exp] 84 / 1e-21 AT5G17190 244 / 6e-85 unknown protein Lus10031957 [exp] 0 / 1 AT5G17190 159 / 3e-51 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G042700 [exp] 176 / 3e-58 AT1G48440 172 / 2e-56 B-cell receptor-associated 31-like (.1) Potri.015G030801 [exp] 176 / 3e-58 AT1G48440 184 / 4e-61 B-cell receptor-associated 31-like (.1) Potri.008G133600 [exp] 84 / 1e-21 AT5G17190 244 / 7e-85 unknown protein Potri.010G108000 [exp] 82 / 6e-21 AT5G17190 245 / 1e-85 unknown protein Potri.015G035400 [exp] 72 / 4e-17 AT3G03160 142 / 1e-44 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05529 [flax] [poplar] Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence Show only first row Show all	>Lus10001080 pacid=23148925 polypeptide=Lus10001080 locus=Lus10001080.g ID=Lus10001080.BGIv1.0 annot-version=v1.0 ATGGCGTTGCAGTGGATGATTCTGGCTTACGTGGTTGCGGCAGAGGTGGCCCTCGTCGTGCTGCTGACAGCTCCCGCCCCGAAGCTGATCAAGAATCAGC TGGTTTCCCTAATTTCTCTCATACTTCAGCCGGCGCTCTTCATCGTGCCGTTTTCCGGATTCCAGCTCCTCGATATTTATTGGAAGAATGAGCATCGCTT GCAGTGCACATCCGACATCTGTACCGCCGCTGAGCGGGATCGTTACGAGAAATCTATGTACAAATCTCAGAGGAATGTGGTCCTATGTGCTGCAGCCTGC ATTCTGTACTGGTGTATGTATCGTATAGCGCAGTACCACAAAGAGATCCAGAAGTTGGAGGAAGTGGAGAAGAGGTACAAGGAGGAGTAA
AA sequence Show only first row Show all	>Lus10001080 pacid=23148925 polypeptide=Lus10001080 locus=Lus10001080.g ID=Lus10001080.BGIv1.0 annot-version=v1.0 MALQWMILAYVVAAEVALVVLLTAPAPKLIKNQLVSLISLILQPALFIVPFSGFQLLDIYWKNEHRLQCTSDICTAAERDRYEKSMYKSQRNVVLCAAAC ILYWCMYRIAQYHKEIQKLEEVEKRYKEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G48440			B-cell receptor-associated 31-...		Lus10001080 [exp]	0	1
AT1G48440			B-cell receptor-associated 31-...		Lus10040126 [exp]	1.0	0.9470
AT4G00585			unknown protein		Lus10007571 [exp]	2.0	0.8822
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10016624 [exp]	3.7	0.8469
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10035094 [exp]	3.9	0.8289
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10015954 [exp]	4.2	0.8486
AT3G46010		ATADF1, ADF1	actin depolymerizing factor 1 ...		Lus10024417 [exp]	4.6	0.8514
AT1G79010			Alpha-helical ferredoxin (.1)		Lus10023571 [exp]	4.9	0.8364
AT3G06170			Serinc-domain containing serin...		Lus10034023 [exp]	5.0	0.8488
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10031084 [exp]	5.3	0.8348
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10024418 [exp]	6.9	0.8465

Compare expression of checked genes

Lus10001080 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.