Lus10001099 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22240 362 / 1e-125 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G04020 357 / 1e-123 FIB fibrillin (.1)
AT2G35490 221 / 1e-69 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT2G42130 58 / 1e-09 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
AT3G58010 55 / 2e-08 PGL34 plastoglobulin 34kD (.1)
AT2G46910 54 / 3e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT5G09820 52 / 2e-07 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT3G26080 48 / 3e-06 plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26070 46 / 1e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT5G53450 43 / 0.0003 ORG1 OBP3-responsive gene 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014790 573 / 0 AT4G22240 363 / 2e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10030987 220 / 3e-69 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10035384 218 / 1e-68 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10020860 66 / 3e-12 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10033514 65 / 5e-12 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10012003 61 / 2e-10 AT2G42130 383 / 3e-134 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Lus10020982 56 / 8e-09 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10016263 56 / 1e-08 AT2G42130 346 / 1e-120 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Lus10004171 55 / 2e-08 AT2G42130 378 / 3e-133 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G003200 370 / 2e-128 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G137900 250 / 4e-81 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G095900 241 / 3e-77 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G309300 67 / 2e-12 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Potri.006G192200 62 / 1e-10 AT2G42130 361 / 1e-125 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Potri.001G209600 57 / 3e-09 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.016G045900 56 / 1e-08 AT2G42130 366 / 1e-127 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Potri.003G020700 51 / 3e-07 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.002G183700 49 / 1e-06 AT2G46910 366 / 2e-128 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Lus10001099 pacid=23171896 polypeptide=Lus10001099 locus=Lus10001099.g ID=Lus10001099.BGIv1.0 annot-version=v1.0
ATGGCAGCCACCACCTCTCGACTGAATCACTTTCTTCCATGCCATACTCTCTCCACCACTCATCAAAACACCTTCTTCGCTACCTATGCTCGTCCCATCA
TCAATTTCCCCGCTGCGGCCTTTACGCTGCAGCGGGTTTCATCCAAACAGTTATTCCGTAACTCACGACCTTATGTCTTGGTTCGTGCAGCCGGAGAAGG
CGTGTCCTCCTCCTCCTCGACCCCGGGCCAGGCATCAACGGTCACCGTTGTCGATGAATCGGATTCAGAGACAGAAAAGTTGAAGAAACAGTTGGTGGAT
TGCTTTTACGGTACGGAGCGTGGGTTGAGAGCAAGCAGCGAAACCAGAGCTGAGATTGGAGAGCTTATCACCCAGCTGGAATCAAAGAACCCTACCCCTT
CACCTACCGACGCTTTGCCTCTTCTCAAGGGAAAGTGGATTCTCTCGTACACGTCTTTCCCGGGGCTGTTCCCTTTGCTGGCGAGGGGGGCTCCCTCACT
GTTGATGGTGGAAGAAATATCTCAAACCATAGATTCCGATAATTTCACCGTCCAGAACTCTGTTCGATTTGCTAGCCCTTATGCTACCACTTCCATCACC
ACCAATGCCAAATTCGAAGTCAGAAGTCCTAAGCGTGTCCAGATAAAGTTTGAAGAAGGGGTGATTGGGACTCCCCAGCTGACTGATTCCATAGTGTTAC
CAGAGAGCGTGGAATTTCTGGGACAGAAGATAGACCTTACCCCTTTCAAAGGGTTGATCACCTCTGTTCAGGACACTGCTTCCACCGTTGCCAAGACCAT
ATCCAGCCAGCCACCCTTCAAGTTTTCCATCCCAAACACTAGCACTGCAGATTCTTGGTTGCTCACCACCTACCTTGACCAAGACCTTCGCATTTCGAGA
GGGGATGCTGGCAGCGTCTTCGTACTTCTTAAACAAGGAAGCCCTCTCCTTGCTTCCCTCTGA
AA sequence
>Lus10001099 pacid=23171896 polypeptide=Lus10001099 locus=Lus10001099.g ID=Lus10001099.BGIv1.0 annot-version=v1.0
MAATTSRLNHFLPCHTLSTTHQNTFFATYARPIINFPAAAFTLQRVSSKQLFRNSRPYVLVRAAGEGVSSSSSTPGQASTVTVVDESDSETEKLKKQLVD
CFYGTERGLRASSETRAEIGELITQLESKNPTPSPTDALPLLKGKWILSYTSFPGLFPLLARGAPSLLMVEEISQTIDSDNFTVQNSVRFASPYATTSIT
TNAKFEVRSPKRVQIKFEEGVIGTPQLTDSIVLPESVEFLGQKIDLTPFKGLITSVQDTASTVAKTISSQPPFKFSIPNTSTADSWLLTTYLDQDLRISR
GDAGSVFVLLKQGSPLLASL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22240 Plastid-lipid associated prote... Lus10001099 0 1
AT5G64230 unknown protein Lus10033177 1.4 0.8825
AT3G61320 Bestrophin-like protein (.1) Lus10037849 2.2 0.8524
AT5G51040 unknown protein Lus10043024 2.4 0.8637
AT5G64230 unknown protein Lus10010617 3.5 0.8537
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10015178 3.9 0.8582
AT1G68070 Zinc finger, C3HC4 type (RING ... Lus10021801 4.2 0.8453
AT5G17350 unknown protein Lus10017620 5.1 0.8168
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10032938 5.1 0.8334
AT5G61640 PMSR1, ATMSRA1 ARABIDOPSIS THALIANA METHIONIN... Lus10033039 7.0 0.8463
AT3G12630 SAP5 stress associated protein 5, A... Lus10015697 8.0 0.8453

Lus10001099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.