Lus10001108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 346 / 5e-118 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530 344 / 3e-117 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 340 / 9e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06650 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350 326 / 4e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640 325 / 2e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT3G61400 321 / 5e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03410 318 / 1e-106 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 317 / 2e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43450 315 / 5e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019435 570 / 0 AT1G06620 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10002892 491 / 6e-175 AT1G06620 381 / 1e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10000426 468 / 7e-166 AT1G06620 412 / 5e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10001118 468 / 7e-166 AT1G06620 412 / 5e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10001109 443 / 4e-156 AT1G06620 379 / 4e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10002888 431 / 3e-151 AT1G06620 384 / 7e-133 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10002894 406 / 3e-140 AT1G06620 369 / 2e-125 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 398 / 4e-138 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 389 / 7e-135 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073300 377 / 5e-130 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 372 / 2e-128 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 353 / 5e-121 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 339 / 3e-115 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G165400 326 / 5e-110 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 322 / 2e-108 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 300 / 9e-100 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 298 / 4e-99 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 298 / 1e-98 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G136000 292 / 9e-97 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10001108 pacid=23148499 polypeptide=Lus10001108 locus=Lus10001108.g ID=Lus10001108.BGIv1.0 annot-version=v1.0
ATGGTTTCCACAACAGTCGATTATGATCGAGATGCTGAACTCAAGGCATTCGACGAAACAAAAGCCGGAGTGAAAGGGCTTGTTGATTCGGGGATCACAG
AGATCCCTCGAATCTTTCACATGCCATCTCATTTGCTGGACCAAGGATTGCCCTTTCCAGCAGACGACCCAGACTTCCTTTTCCCAATCATAGATCTGCA
GGACGGCCAAAACCCGGAGAAGCGGAAGCAGATTGTTGAGAAAATCGGGGACGCGGCCAAAAACTGGGGCTTCTTCCAAATAGTGAACCATGGAACACCT
ATAGAAATCCTGGAGGAGATGATAGCAGGAGTCCACAGGTTCTTTAACCAAGATGTCGAGCTGAAGAAGAAAGTGGGTGTGGACATGACCAAGGAGGTTG
TTTACTACCCAAGCAATCCTGATCTCTACACCTCAGAAGCTGCAAATTGGAGGGATTCCATCCTCTATCGCATGACACCAAACCCACCTGAAGCAGAGCG
ATTGCCGGCTTGCTCCAGGGAAATCGTGCCCAAGTATTCGGCTGAAATGCTGAAATTGGGGGATTTGGTTTTCCAGTTGCTGTCTGAGTCTTTGAGTCTA
CCCTCGGATTACCTCAAAGAATTGGATTGTATGGAAGTACTGGCATTAGGGTGCCATTACTATCCAGCTTGTCCTCAGCCAAAACTCACCTTGGGAACTA
TCGGCCATGCTGATCTTGATTTTCTTACGCTTCTTCTGCAAGACAACGTCGGAGGTCTTCAGATCCGTCGCAAGGGTCATTGGGTCGATGTGCCTTTTAC
TAAAGGAGCCATAGTAGTCAACATCGGAGAGATGCTTCAGCTTCTATCCAACGACAAGTTCACAAGTGTAGAGCATAGAGTGATAGCGAAAGATGTTGGC
CCGCGGGTGTCAATAGCAGGGTTTTTCGGCAATGGGTTCTCGCTTAAGTCCAGAATGTATGGACCCATCAAAGAGACATTATCTGAAGACAACCCTCCAT
TATATAAGAACATCACAATCAAAGATTTCTTTGCCCTGACCTTTAAAAACGGCATTGGTAAATCAGTTCTGCCACTCCTTAAGCTCTGA
AA sequence
>Lus10001108 pacid=23148499 polypeptide=Lus10001108 locus=Lus10001108.g ID=Lus10001108.BGIv1.0 annot-version=v1.0
MVSTTVDYDRDAELKAFDETKAGVKGLVDSGITEIPRIFHMPSHLLDQGLPFPADDPDFLFPIIDLQDGQNPEKRKQIVEKIGDAAKNWGFFQIVNHGTP
IEILEEMIAGVHRFFNQDVELKKKVGVDMTKEVVYYPSNPDLYTSEAANWRDSILYRMTPNPPEAERLPACSREIVPKYSAEMLKLGDLVFQLLSESLSL
PSDYLKELDCMEVLALGCHYYPACPQPKLTLGTIGHADLDFLTLLLQDNVGGLQIRRKGHWVDVPFTKGAIVVNIGEMLQLLSNDKFTSVEHRVIAKDVG
PRVSIAGFFGNGFSLKSRMYGPIKETLSEDNPPLYKNITIKDFFALTFKNGIGKSVLPLLKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10001108 0 1
AT2G18150 Peroxidase superfamily protein... Lus10028337 2.2 0.9627
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10006978 3.5 0.9527
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028897 4.5 0.9475
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10007248 4.5 0.9546
AT1G19130 unknown protein Lus10027661 6.0 0.9393
AT1G05030 Major facilitator superfamily ... Lus10035315 7.5 0.9399
AT3G01980 NAD(P)-binding Rossmann-fold s... Lus10041545 7.9 0.9275
AT5G25140 CYP71B13 "cytochrome P450, family 71, s... Lus10018263 9.2 0.9402
AT4G20140 GSO1 GASSHO1, Leucine-rich repeat t... Lus10036251 11.0 0.9397
Lus10002465 11.0 0.9451

Lus10001108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.