Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54090 71 / 9e-16 ATEXO70D2 exocyst subunit exo70 family protein D2 (.1) AT1G72470 67 / 2e-14 ATEXO70D1 exocyst subunit exo70 family protein D1 (.1) AT3G14090 57 / 6e-11 ATEXO70D3 exocyst subunit exo70 family protein D3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008126 [exp] 97 / 6e-25 AT1G72470 862 / 0.0 exocyst subunit exo70 family protein D1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G166400 [exp] 82 / 1e-19 AT1G72470 822 / 0.0 exocyst subunit exo70 family protein D1 (.1) Potri.003G068700 [exp] 81 / 3e-19 AT1G72470 810 / 0.0 exocyst subunit exo70 family protein D1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001112 pacid=23148492 polypeptide=Lus10001112 locus=Lus10001112.g ID=Lus10001112.BGIv1.0 annot-version=v1.0 ATGGGGTCACCGGCGGAGATTAACAGTGGTGGGGGTAGCAGCAGCAACAGCGGCGACTTTGATTTTGAAGAAGCACAAAAGATAATACTGAGATGGGACA TGTCAGCATCGGAGGAAGCGAGGGAGAAGATGGTGTTTGCTGGCGACCGTCAAGAAGTGGATCTCTATCTGCAGGCAGTTAACGAAATCCAGAAGTCGAT GTCCTCCGCTTCAATCTCCGCCACCGACGGAGGCATCGGTGGATGTGAAATGCAAAAACGATGA
AA sequence Show only first row Show all	>Lus10001112 pacid=23148492 polypeptide=Lus10001112 locus=Lus10001112.g ID=Lus10001112.BGIv1.0 annot-version=v1.0 MGSPAEINSGGGSSSNSGDFDFEEAQKIILRWDMSASEEAREKMVFAGDRQEVDLYLQAVNEIQKSMSSASISATDGGIGGCEMQKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72470		ATEXO70D1	exocyst subunit exo70 family p...		Lus10001112 [exp]	0	1
					Lus10015042 [exp]	3.5	0.5882
AT4G14103			F-box/RNI-like superfamily pro...		Lus10020634 [exp]	12.9	0.5685
AT1G08030		AQC1, TPST	active quiescent center1, tyro...		Lus10016093 [exp]	21.8	0.5365
					Lus10000350 [exp]	22.8	0.4915
AT4G14103			F-box/RNI-like superfamily pro...		Lus10020635 [exp]	23.0	0.5473
					Lus10002071 [exp]	39.7	0.4756
AT3G12720	MYB	ATMYB67, AtY53	myb domain protein 67 (.1)		Lus10038395 [exp]	41.6	0.5188
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Lus10020147 [exp]	44.6	0.5079
AT2G45040			Matrixin family protein (.1)		Lus10042881 [exp]	52.8	0.5020
AT5G18580		FASS2, TON2, GD...	GORDO, FASS 1, EMBRYO DEFECTIV...		Lus10002884 [exp]	59.2	0.4774

Compare expression of checked genes

Lus10001112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.