Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026085 [exp] 40 / 5e-05 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10017775 [exp] 40 / 8e-05 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10028119 [exp] 39 / 0.0002 AT1G30130 368 / 2e-121 unknown protein Lus10026084 [exp] 0 / 1 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001119 pacid=23161784 polypeptide=Lus10001119 locus=Lus10001119.g ID=Lus10001119.BGIv1.0 annot-version=v1.0 ATGTCCGATCTTCAACAGGCTCTCTGTCTGGCCTTGCCTCTTACTCTGATTTCAACATTGCTTTACAGTTTGATCGCAAACCCAATCCTTGTTCAGCGTC GTCTGAATTACTTTGGAATCAGAGACCATCCATCCTACAGATTCTTCTCTGGAAATTCAGAAGCTAAGAAAAGCCGCGCGGGCCATGGCAAAAACCATGC CAGGATTCCTGGGATCAACAAGATTTACAAAAGCAGAGCTGATACCGAAGCAAACCAAGCTTGA
AA sequence Show only first row Show all	>Lus10001119 pacid=23161784 polypeptide=Lus10001119 locus=Lus10001119.g ID=Lus10001119.BGIv1.0 annot-version=v1.0 MSDLQQALCLALPLTLISTLLYSLIANPILVQRRLNYFGIRDHPSYRFFSGNSEAKKSRAGHGKNHARIPGINKIYKSRADTEANQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001119 [exp]	0	1
AT4G30030			Eukaryotic aspartyl protease f...		Lus10011612 [exp]	4.6	0.8119
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	9.3	0.6975
					Lus10033149 [exp]	11.4	0.6975
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10003281 [exp]	13.1	0.6975
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10006200 [exp]	14.7	0.6975
AT4G30720		PDE327	PIGMENT DEFECTIVE 327, FAD/NAD...		Lus10010777 [exp]	16.1	0.6262
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	16.1	0.6975
AT3G14040			Pectin lyase-like superfamily ...		Lus10023364 [exp]	17.3	0.6975
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027028 [exp]	18.5	0.6975
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	19.7	0.6975

Compare expression of checked genes

Lus10001119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.