Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42440 95 / 2e-24 Protein kinase superfamily protein (.1) AT3G13380 65 / 3e-13 BRL3 BRI1-like 3 (.1) AT1G72300 65 / 3e-13 Leucine-rich receptor-like protein kinase family protein (.1) AT1G55610 64 / 9e-13 BRL1 BRI1 like (.1.2) AT5G62710 59 / 5e-11 Leucine-rich repeat protein kinase family protein (.1) AT5G38560 58 / 7e-11 AtPERK8 proline-rich extensin-like receptor kinase 8, Protein kinase superfamily protein (.1) AT5G48380 58 / 8e-11 BIR1 BAK1-interacting receptor-like kinase 1 (.1) AT1G27190 57 / 2e-10 Leucine-rich repeat protein kinase family protein (.1) AT2G02220 56 / 4e-10 ATPSKR1 phytosulfokin receptor 1 (.1) AT4G28650 56 / 5e-10 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015344 [exp] 191 / 4e-61 AT5G42440 400 / 6e-139 Protein kinase superfamily protein (.1) Lus10003477 [exp] 60 / 2e-12 AT1G74360 171 / 1e-50 Leucine-rich repeat protein kinase family protein (.1) Lus10016395 [exp] 59 / 6e-11 AT1G72300 1170 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10019722 [exp] 58 / 7e-11 AT1G72300 1189 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10033104 [exp] 56 / 5e-10 AT5G62710 934 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10001212 [exp] 56 / 5e-10 AT3G09010 384 / 2e-128 Protein kinase superfamily protein (.1) Lus10002147 [exp] 56 / 5e-10 AT5G48380 755 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10008743 [exp] 56 / 5e-10 AT5G48380 764 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10036672 [exp] 56 / 6e-10 AT5G62710 936 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G195500 [exp] 124 / 3e-35 AT5G42440 388 / 2e-134 Protein kinase superfamily protein (.1) Potri.002G065400 [exp] 114 / 2e-31 AT5G42440 387 / 4e-134 Protein kinase superfamily protein (.1) Potri.011G049600 [exp] 63 / 1e-12 AT3G09010 427 / 2e-149 Protein kinase superfamily protein (.1) Potri.001G161000 [exp] 62 / 2e-12 AT1G72300 1199 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.003G074000 [exp] 61 / 8e-12 AT1G72300 1215 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.011G101900 [exp] 58 / 9e-12 AT1G78530 210 / 2e-68 Protein kinase superfamily protein (.1) Potri.001G380800 [exp] 60 / 1e-11 AT1G78530 535 / 0.0 Protein kinase superfamily protein (.1) Potri.011G169600 [exp] 59 / 3e-11 AT1G55610 1500 / 0.0 BRI1 like (.1.2) Potri.018G107400 [exp] 59 / 4e-11 AT2G24230 1153 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.012G071100 [exp] 59 / 4e-11 AT5G62710 943 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10001120 pacid=23161791 polypeptide=Lus10001120 locus=Lus10001120.g ID=Lus10001120.BGIv1.0 annot-version=v1.0 ATGGGGTACATGCCGCCGGAGTACAAAGACGGGGTAGTGGCGGCGACAGTGAAGGCGGATGTGTATAGTTTCGGGATATTGATGTTCGAGATAGCGACGG GAGAGAGGCCGAACTTGCCGATGTTGTTCAAGGGAAAGGAGATGGAGAAGGGTAAGGAGATGGGGTTGATTGAATGGGCTCGGAGAATGATGGGGGAAAA TAGTTACGAGGAAATGTTGGACGCAAGTATGGGGAAGGAAGGGGTGACTGAAGAGAAAGTGAAGGAATACTTTAGAATTGCTTCAATGTGCTGCAATGAA ATAAATGGAGAAAGACCAGTGATGCCTCAAGTTGTGGATTTGTTGAATACACTTTCTGCTTAG
AA sequence Show only first row Show all	>Lus10001120 pacid=23161791 polypeptide=Lus10001120 locus=Lus10001120.g ID=Lus10001120.BGIv1.0 annot-version=v1.0 MGYMPPEYKDGVVAATVKADVYSFGILMFEIATGERPNLPMLFKGKEMEKGKEMGLIEWARRMMGENSYEEMLDASMGKEGVTEEKVKEYFRIASMCCNE INGERPVMPQVVDLLNTLSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42440			Protein kinase superfamily pro...		Lus10001120 [exp]	0	1
AT1G61390			S-locus lectin protein kinase ...		Lus10018407 [exp]	1.7	0.8489
AT5G42440			Protein kinase superfamily pro...		Lus10015344 [exp]	2.0	0.8491
AT3G14470			NB-ARC domain-containing disea...		Lus10000417 [exp]	2.8	0.8024
AT5G42050			DCD (Development and Cell Deat...		Lus10032412 [exp]	3.9	0.8568
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10034193 [exp]	4.9	0.7969
AT5G65520			Tetratricopeptide repeat (TPR)...		Lus10012031 [exp]	5.5	0.8179
AT5G51190	AP2_ERF		Integrase-type DNA-binding sup...		Lus10032499 [exp]	8.1	0.8108
AT5G51190	AP2_ERF		Integrase-type DNA-binding sup...		Lus10042996 [exp]	11.1	0.8244
AT5G65520			Tetratricopeptide repeat (TPR)...		Lus10016283 [exp]	11.2	0.7805
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Lus10016519 [exp]	12.4	0.8106

Compare expression of checked genes

Lus10001120 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.