Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03560 130 / 2e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G74850 64 / 2e-13 PDE343, PTAC2 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1) AT4G38150 62 / 9e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) AT3G25210 61 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G31840 60 / 5e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G61990 59 / 1e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G05670 58 / 3e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) AT1G06580 56 / 1e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G19440 56 / 1e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G14770 56 / 2e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013853 [exp] 65 / 1e-13 AT4G38150 304 / 2e-102 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Lus10026570 [exp] 64 / 3e-13 AT4G38150 303 / 5e-102 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Lus10013972 [exp] 61 / 5e-12 AT5G46100 520 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015397 [exp] 61 / 5e-12 AT5G46100 593 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10025013 [exp] 59 / 2e-11 AT1G05670 161 / 1e-43 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Lus10013841 [exp] 58 / 3e-11 AT5G65560 868 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026558 [exp] 58 / 3e-11 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013077 [exp] 58 / 4e-11 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038974 [exp] 58 / 4e-11 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G209500 [exp] 62 / 8e-13 AT4G38150 314 / 4e-106 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Potri.010G035700 [exp] 60 / 5e-12 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Potri.003G105700 [exp] 59 / 2e-11 AT4G19440 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G050180 [exp] 58 / 3e-11 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.002G248100 [exp] 57 / 5e-11 AT3G25210 506 / 2e-180 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G090600 [exp] 57 / 8e-11 AT5G08310 851 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G046000 [exp] 57 / 1e-10 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G297300 [exp] 56 / 1e-10 AT5G02860 1129 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G014500 [exp] 56 / 1e-10 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.009G092100 [exp] 56 / 2e-10 AT5G02860 1146 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10001125 pacid=23161785 polypeptide=Lus10001125 locus=Lus10001125.g ID=Lus10001125.BGIv1.0 annot-version=v1.0 ATGCCTGATGTAGCAGCTTACACAGCGGTGATAGAAGTCTATGCCAAGGCCGGTGGGCAGTCAAAAGAAGCCCTGAAGGTGTTCATGAGAATGCTCGCCT CTGGAGTTGCTCCCAATGCATACACTTACAGTGTGTTGGTCAAGGGACTGGCTGCCGATGCCAAAATTGGTGATGGTAAGAAGTATCTGCTGGAAATGAT GGGGAAAGGGATGAGGCGGAATGCTGGGACTTACTGTGCGGTGTTTGAAGGTTTGGTGAGAGGAGAGAGTTGA
AA sequence Show only first row Show all	>Lus10001125 pacid=23161785 polypeptide=Lus10001125 locus=Lus10001125.g ID=Lus10001125.BGIv1.0 annot-version=v1.0 MPDVAAYTAVIEVYAKAGGQSKEALKVFMRMLASGVAPNAYTYSVLVKGLAADAKIGDGKKYLLEMMGKGMRRNAGTYCAVFEGLVRGES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03560			Tetratricopeptide repeat (TPR)...		Lus10001125 [exp]	0	1
AT5G49230		HRB1	HYPERSENSITIVE TO RED AND BLUE...		Lus10017097 [exp]	8.4	0.8194
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10002264 [exp]	21.3	0.8024
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10003772 [exp]	31.6	0.7905
AT5G16790		AtTHO7	Tho complex subunit 7/Mft1p (....		Lus10030532 [exp]	33.2	0.7574
AT5G58040		FIP1[V], ATFIP1...	homolog of yeast FIP1 [V], hom...		Lus10019609 [exp]	36.9	0.7976
					Lus10011965 [exp]	47.9	0.7712
AT3G09670			Tudor/PWWP/MBT superfamily pro...		Lus10012010 [exp]	58.7	0.7446
AT5G53940			Yippee family putative zinc-bi...		Lus10015416 [exp]	68.4	0.7552
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10035404 [exp]	70.3	0.7398
					Lus10037168 [exp]	79.9	0.7699

Compare expression of checked genes

Lus10001125 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.